NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C103H176N40O23

H-GRRRQRRKKRGGTFLYPPL-OH (All D-amino acids)

C46H89N15O11

H-GLLKRIKTT-NH2 (amidation)

C129H215N33O55

Acetylation-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH

C68H124N16O17

H-GLLDLLKLLLKAAG-OH

C122H205N33O25

H-WFGKLYRGKTKVVKKVKGLLKG-OH

C140H213N41O25

H-RFRPPIRRPPIRPPFYPPFRPPI-OH

C151H232N46O27

H-RFRPPIRRPPIRPPFYPPFRPPIRP-OH

C106H178N24O17

H-FFKLIPKLVKKLIKAFK-Amidation

C100H164N22O19

H-FFSLIPSLVKKLIKAFK-Amidation

C71H118N18O18

H-INIINAPLQGFKIA-OH

C85H142N26O23

H-LVQIGTKIVGVGRNYAAH-OH

C90H157N29O23

H-AGDKKIKIGINGFGRIGRL-OH

C131H199N39O23

Ac-HARIKpTFRRlKWKYKGKFW (where proline and leucine are D-form amino acids, and the N-terminal was blocked by acetylation)

C207H331N69O53S

H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK-Amidation

C84H134N22O17S

H-YPCKLNLKLGKVPFH-Amidation

C75H127N19O17

H-INWLKLGKAIIDAL-Amidation

C126H211N33O31S2

H-LSFQQVKEKVCKVEAKIGKKLPFC-Amidation

C61H117N21O11S

H-MARVLLRLIRL-NG2

C67H110N20O11S

H-FRLMLRLLRW-OH

C193H331N59O51S

H-gfrkrfnklvkkvkhtiketanvskdvaivagsgvavgaam-NH2 (D-form))

C185H317N59O52

H-gwlkkigkkiervgqhtrdatiqtigvaqqaanvaatlk-NH2 (all D-form)

C193H331N59O51S

H-GFRKRFNKLVKKVKHTIKETANVSKDVAIVAGSGVAVGAAM-NH2

C185H317N59O52

H-GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK-NH2

C115H198N34O23

H-rlvrilvskrpvaikpyfrl-OH (D-form)

C107H191N45O27

H-TTSIRRRYQVSLIRRHRGKR-OH

C115H198N34O23

H-RLVRILVSKRPVAIKPYFRL-OH

C80H148N20O17

H-KKLLPIVANLLKSLL-NH2

C72H108N18O15

H-FLQHIIGALGHLF-OH

C186H317N55O42

H-KWKLFKKIHKVGQNIRKGIIKAGPAVAVVGQAAQIAK-OH

C124H225N61O28S2

H-RRRRRRRRGGGGRKTGHQICKFRKC-OH

C92H182N54O19

H-KNKRKRRRRRRGGRRRR-OH

C158H290N74O35

H-TLISWIKNKRKQRPRVSRRRRRRGGRRRR-OH

C74H119N21O20

H-VAIALKAAHYHTAKE-OH

C74H120N22O19

H-VAIALKAAHYATHKE-Amidation

C74H120N22O19

H-VAIALKAAAYHTHKE-Amidation

C85H144N22O14

H-IKKWWSKIKKLLK-NH2

C85H144N22O14

H-WKKIWSKIKKLLK-NH2

C227H364N84O65S3

H-RPRGMTSSQWFRIQHMQPSPQASNSAMRNINRHTRRSRDLNTFLH-OH

C246H382N66O62S

H-KPPQFTKAQWFAIQHISLNPPKSTIAMKAINNYKWKSKNQNTFLK-OH