Human elongation factor-1 alpha (EF-1 alpha) is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts. EF-1 alpha is often useful in conditions where other promoters (such a...
View More>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP...
View MoreJeff Lawrence (Z51)(NOTE: This section describes classic green plates, which have now been superceded by "Mint Green Plates")Plate Mix 828 g Bacto-Tryptone (Difco) 105 g Yeast Extract (Difco) 516 g NaCl 1551...
View MoreProtocolModification of Jeff Lawrence (X10)1. Prepare media in two flasks: Flask A 12 g Agar 4 g Tryptone 4 g Yeast Extract 40 mg Anhydrotetracycline 400 mL Water Flask B 8 g NaCl 8 g NaH...
View MoreAmino acid Stock Concentration Molecular Weight gm/100ml ...
View MoreJeff Lawrence (Z50)50X E Salts1. Heat 1 L distilled water in a 4 liter beaker.2. Dissolve completely, in indicated order: 300 g citric acid monohydrate (H3C6H5O7·H2O) 14.1 g MgSO4 1965 g K2HPO4·3H2O 525&nb...
View MoreAntibiotic AbbreviationConcentration1Concentration1Stock Solution2 (Rich Media)(Minimal Media)ml/liter Na Ampicillin3 Amp, Ap 50 μg/ml 15 μg/ml4 20 mg/mL 50% EtOH Chloramphenicol Cam, Cm 20 μg/...
View MoreSubstancepKadpKa/dTMrOxalate (oxalic acid) (pK1)1.2790.0Maleate (maleic acid) (pK1)2.000116.1Phosphate (phosphoric acid) (pK1)2.150.004498.0Glycine (pK1)2.35−0.00275.1Phthalate (phthalic acid) (pK1)2.950.0020166.1Glycylglycine (pK1)3.12132.1Malate (m...
View MoreTo predict transcription factor binding site in DNA, you may use the following tools:1. PROMOPROMO is a virtual laboratory for the identification of putative transcription factor binding sites (TFBS) in DNA sequences from a species or groups of speci...
View MoreThe common perception of scaling of dose based on the body weight (mg/kg) alone is not the right approach. This is primarily because the biochemical, functional systems in species vary which in turn alter pharmacokinetics. Therefore, extrapolation of...
View More