New Articles List

For producing lentivirl particles you typically need three components: 1) a lentiviral vector, such as pLKO.1 or pLVTHM or pLVX-PURO, containing the shRNA or transgene, 2) a packaging vector, such as psPAX2 or pCMV-dR8.2 dvpr and 3) an envelop vector...

View More

INCI Name Sequence CAS Molecular Formula ...

View More

(1) CyclizationHead-to-tail cyclic, stapled peptide, side chain cyclic, multiple disulfide-bonds cyclic (Sec&Sec), monothioether cyclic, click chemistry, Cyclization via xylene or mesitylene(2) Isotopic labeling13C, 15N modified R or K (D type or...

View More

Cyclisation Cyclisation techniques have been used widely in the peptide field and achieved in several ways from cyclising head to tail, head/tail to side chain or side chain to side chain. A type of side chain to side chain cyclisati...

View More

Human elongation factor-1 alpha (EF-1 alpha) is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts. EF-1 alpha is often useful in conditions where other promoters (such a...

View More

>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP...

View More

Jeff Lawrence (Z51)(NOTE: This section describes classic green plates, which have now been superceded by "Mint Green Plates")Plate Mix 828 g Bacto-Tryptone (Difco) 105 g Yeast Extract (Difco) 516 g NaCl 1551...

View More

ProtocolModification of Jeff Lawrence (X10)1. Prepare media in two flasks: Flask A 12 g Agar 4 g Tryptone 4 g Yeast Extract 40 mg Anhydrotetracycline  400 mL Water Flask B 8 g NaCl 8 g NaH...

View More

Amino acid Stock Concentration Molecular Weight gm/100ml ...

View More

Jeff Lawrence (Z50)50X E Salts1. Heat 1 L distilled water in a 4 liter beaker.2. Dissolve completely, in indicated order: 300 g citric acid monohydrate (H3C6H5O7·H2O)  14.1 g MgSO4  1965 g K2HPO4·3H2O 525&nb...

View More