NovoPro
Cart 2

New Articles List

Mouse, human and rabbit Fc tag sequences

>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP...

View More

Green Indicator Plates

Jeff Lawrence (Z51)(NOTE: This section describes classic green plates, which have now been superceded by "Mint Green Plates")Plate Mix 828 g Bacto-Tryptone (Difco) 105 g Yeast Extract (Difco) 516 g NaCl 1551...

View More

50X E Salts and Derivatives

Jeff Lawrence (Z50)50X E Salts1. Heat 1 L distilled water in a 4 liter beaker.2. Dissolve completely, in indicated order: 300 g citric acid monohydrate (H3C6H5O7·H2O)  14.1 g MgSO4  1965 g K2HPO4·3H2O 525&nb...

View More

Antibiotic Stock Solutions

Antibiotic AbbreviationConcentration1Concentration1Stock Solution2  (Rich Media)(Minimal Media)ml/liter Na Ampicillin3 Amp, Ap 50 μg/ml 15 μg/ml4 20 mg/mL 50% EtOH  Chloramphenicol Cam, Cm 20 μg/...

View More

How to predict transcription factor binding site?

To predict transcription factor binding site in DNA, you may use the following tools:1. PROMOPROMO is a virtual laboratory for the identification of putative transcription factor binding sites (TFBS) in DNA sequences from a species or groups of speci...

View More

How to convert human dose to animal dose?

The common perception of scaling of dose based on the body weight (mg/kg) alone is not the right approach. This is primarily because the biochemical, functional systems in species vary which in turn alter pharmacokinetics. Therefore, extrapolation of...

View More

Does PBS buffer affect cell adhesion?

Cell adhesion is a pH-dependent phenomenon: the cells required Mg2+ or Ca2+ for attachment to substrates at pH higher than the isoelectric point of the proteins coating a plastic surface, but not at lower pH. With increasing pH from 3.4, cell adhesiv...

View More