New Articles List

Cyclisation Cyclisation techniques have been used widely in the peptide field and achieved in several ways from cyclising head to tail, head/tail to side chain or side chain to side chain. A type of side chain to side chain cyclisati...

View More

Human elongation factor-1 alpha (EF-1 alpha) is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts. EF-1 alpha is often useful in conditions where other promoters (such a...

View More

>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP...

View More

Jeff Lawrence (Z51)(NOTE: This section describes classic green plates, which have now been superceded by "Mint Green Plates")Plate Mix 828 g Bacto-Tryptone (Difco) 105 g Yeast Extract (Difco) 516 g NaCl 1551...

View More

ProtocolModification of Jeff Lawrence (X10)1. Prepare media in two flasks: Flask A 12 g Agar 4 g Tryptone 4 g Yeast Extract 40 mg Anhydrotetracycline  400 mL Water Flask B 8 g NaCl 8 g NaH...

View More

Amino acid Stock Concentration Molecular Weight gm/100ml ...

View More

Jeff Lawrence (Z50)50X E Salts1. Heat 1 L distilled water in a 4 liter beaker.2. Dissolve completely, in indicated order: 300 g citric acid monohydrate (H3C6H5O7·H2O)  14.1 g MgSO4  1965 g K2HPO4·3H2O 525&nb...

View More

Antibiotic AbbreviationConcentration1Concentration1Stock Solution2  (Rich Media)(Minimal Media)ml/liter Na Ampicillin3 Amp, Ap 50 μg/ml 15 μg/ml4 20 mg/mL 50% EtOH  Chloramphenicol Cam, Cm 20 μg/...

View More

SubstancepKadpKa/dTMrOxalate (oxalic acid) (pK1)1.2790.0Maleate (maleic acid) (pK1)2.000116.1Phosphate (phosphoric acid) (pK1)2.150.004498.0Glycine (pK1)2.35−0.00275.1Phthalate (phthalic acid) (pK1)2.950.0020166.1Glycylglycine (pK1)3.12132.1Malate (m...

View More

To predict transcription factor binding site in DNA, you may use the following tools:1. PROMOPROMO is a virtual laboratory for the identification of putative transcription factor binding sites (TFBS) in DNA sequences from a species or groups of speci...

View More