Neuropeptides

Product ID

Product Name

Sequence

Formula

AGEGLSSPFWSLAAPQRF

C89H130N24O24

YPSKPDNPGEDAPAEDLARYYSALRHYINLITRPRY

C190H286N54O56

DAGHGQISHKRHKTDSFVGLM

C99H158N34O29S

EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV

C182H282N54O52S4

PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY

C181H278N54O55

WYKHVASPRYHTVGRASGLLMGL

C119H183N35O29S

SALRHYINLITRQRY

C85H139N29O21

SGSAKVAFSAIRSTNH

C69H113N23O23

pGlu-ATVGDINTERPGMLDFT

C83H130N22O30S

Biotin-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYK

C199H300N57O60S2

LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL

C167H259N47O57S2

DVPKSDQFVGLM

C59H95N15O18S

QATVGDINTERPGMLDFTGK

C91H148N26O32S