Product Name

Molecular Formula

Sequence

C73H117N23O25S

H-KETAAAKFERQHMDS-OH

C59H103N27O17

H-RRVRRGSDPIHN-OH

C116H184N30O29S

H-GIGKFLHSAKKFAKAFVAEIMNS-OH

C82H138N32O22

H-TRSSRAGLQFPVGRVHR-OH

C115H207N43O23

H-RAGLQFPVGRLLRRLLRRLLR-OH

C17H30N8O9

H-GRGDS-OH

C109H157N27O28S

H-AIMYSWYFPKDSPVTGLGHR-OH

C20H33N5O9

Ac-SDKP-OH

DR8

C40H65N17O13

H-DHNNPQIR-NH2

PMI

C68H94N14O20

H-TSFAEYWNLLSP-OH

CBP

C50H84N18O16S

H-LRELHLNNNC-OH

C258H401N79O78

H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

C60H94N14O14

H-VSGWALFKKIS-OH

C34H54N8O12

H-STFTKSP-OH

C122H203N47O33

H-SESSSKSRWGRPVGRRRRPVRVYP-OH

C56H97N15O11S

H-KIKMVISWKG-NH2, all D-AA

C142H214N36O35S

H-MGVKFFTLSTRFFPSVQRAVPLWTNS-OH

C190H309N57O43

H-TFFRLFNRSFTQALGKGGGKNLRIIRKGIHIIKKY-OH

C88H142N26O21S

H-RGVPHIVMVDAYKRYK-OH

C140H262N52O33

H-LRRLSLGLRRLSLGLRRLSLGLRRLSLG-OH

C65H106N18O22

H-YEALRVANEVTLN-OH

C47H71N13O19

H-AANDENYALAA-OH

C45H71N11O15

H-SYQPLGDKV-OH

C47H85N11O12S

H-AIIGLMVGGVV-OH

C73H111N17O30

H-KPSTELEYLGPDEND-OH

C40H68N12O12

H-GVVHGVATVA-OH

DP7

C70H122N24O14

H-VQWRIRVAVIRK-OH

C34H62N16O8

H-RPARPAR-OH

C66H113N29O25

Ac-RADARADARADARADA-NH2

C102H178N36O32

H-EIKARGKNKTKPTPSSGKGGKHN-OH

SAP

C63H91N25O15S

H-MSPHPHPRHHHT-OH

C65H111N23O15

H-WAGAKRLVLRRE-OH

P51

C106H134N24O28S

H-CDTFPYLGWWNPNEYRY-OH

C28H43N9O9

Ac-IEAR-pNA

C81H147N27O24

H-KQLATKAARKSAPATGGVK-OH

C65H115N25O14

H-RAFIASRRIKRP-OH

C118H177N35O29S

H-MEVGWYRSPFSRVVHLYRNGK-OH

C20H35N7O8S

H-CALNN-OH

C147H211N47O42

H-GFWGGLGYIAGRVGAAYGHAQASANNHHSPING-OH

C45H74N10O13

H-SIINFEKL-OH