Product Name

Molecular Formula

Sequence

C147H211N47O42

H-GFWGGLGYIAGRVGAAYGHAQASANNHHSPING-OH

C149H243N53O39S

H-RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG-OH

C182H275N55O48S

H-GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR-OH

C188H293N53O44S

H-PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG-OH

C91H161N33O19

H-RAGLQFPVGRLLRRLLR-OH

C82H152N40O23

H-GRRRQRRKKRGGPGSGGSL-OH (All D-amino acids)

C41H58N12O9

H-SFHFGRL-OH

C71H126N26O12

H-VRLIVAVRIWRR-NH2

C64H120N24O17

H-RKRLQVQLSIRT-OH

C75H105N17O22

H-GHPGYINFSYEVLT-OH

C57H69N13O12S2

Biotin-HWGMWSY-OH

C94H140N26O27

H-SGSLSTFFRLFNRSFTQA-OH

C27H42N8O9

H-PQGPPQ-OH

S3

C174H282N52O41S2

H-MASGVAVSDGVIKVFNRQIKIWFQNRRMKWKK-OH

QP5

C115H178N34O37S

H-QPYQPVQPHQPMQPQTKREEVD-OH

C42H65N13O12S3

H-CGEMGWVRC-OH

TAT

C67H123N33O15S

H-YGRKKRRQRRRC-OH

C28H51N11O9S

H-NVVRQC-OH

C75H147N45O17S

H-CVSRRRRRRGGRRRR-OH

C94H165N29O33

H-TRLSSGLKINSAKDDAAGLQIA-OH

C40H56N12O10

H-THALWHT-OH

C175H289N47O34

H-KFFKKLKNSVKKRAKKFFKKPRVIGVSIPF-OH

C134H220N38O31

H-IWLTALKFLGKHAAKHEAKQQLSKL-NH2

C96H137N21O37

H-YSPTSPSYSPTSPSYSPTSPS-OH

C50H67N13O13

H-WSHPQFEK-OH

C48H76N16O12

H-IHGHHIISVG-OH

C90H154N30O17

Myrisitic Acid-SIYRRGARRWRKL-OH

C103H170N24O25S

Ac-VTIFVAGVLTASLTIWKKMG-NH2

C153H266N38O38S2

H-SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK-OH

C19H35N9O7

Ac-rER, r=D-Arg

p15

C73H122N18O23

H-TSFGILLDLSRTSLP-OH

C62H96N16O20

H-ALLANHEELFQT-OH

R16

C64H96N16O24

H-ADGSSWEGVGVVPDV-OH

C111H184N30O35

Myrisitic Acid-GAQFSKTAAKGEAAAERPGEAAVA-OH

C186H288N58O57S

H-SNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF-NH2

C37H62N14O12S2

H-CSSPIGRHC-OH

C43H60N8O11

H-LTVSPWY-OH

C41H61N7O10S

H-TYFAVLM-OH

C71H126N26O12

H-VRLIVAVRIWRR-NH2

C75H112N18O17S

H-APKHKEMPFPKYP-OH