NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C159H261N55O40

H-YGRKKRRQRRRFGRDEAPEPTQFPIPVKI-OH

C141H242N52O37S

H-YGRKKRRQRRRPDGVLAEALAMFRKTE-OH

C80H113N25O27

GNWDYNSQRAQLYNQ

C28H47N9O5S2

AMMRF-NH2, AVFRM-NH2, SVFRL-NH2

C188H300N62O34

RRIRFRPPYLPRPGRRPRFPPPFPIPRIPRIP

C65H112N20O19S2

QKISRCQVCVKYS

C83H114N18O23S2

Ac-LPSDDLEFWCHVMY-NH2

C81H130N30O19S1

RSMRLSFRARGYGFR (all D-type amino acids)

C89H147N29O25

SPLERNAIKGYRYLSTR-NH2

C105H177N29O35S1

GSGSGSTYLCGAISLAPKAQIKESL

C72H142N44O16

VSRRRRRRGGRRRR

C104H150N29O31

TFFYGGSRGKRNNFKTEEY

C24H34N8O8S

c(RGDyC)

C27H41N9O8

c(RGDyK)

C27H41N9O7

c(RGDfK)

C114H180N30O29S

GIGKFLHSAKKFGKAFVGEIMNS

C139H225N41O33

XRQNTRYSRIEWIKIQIISKLRL-amide (X = 2-naphthoxyacetyl group)

C104H171N37O22

Gu-ONNRPVYIPRPRPPHPRL-OH (Gu = N,N,N’,N’-tetramethylGuanidino and O = L-ornithine)

C26H38N8O7

c(RGDfV)

C34H54N8O9

H-LSFGSLP-NH2

C44H64N8O9

H-LPPYLFT-NH2

C228H388N86O64

H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

C144H234N44O47

TRSAWPSTAASGLLEDPLPHTSRTSLEPSLR

C55H85N11O20

DLDSVLDPSIF

C77H113N23O24

SPALADEHNDNFLRF

C49H82N18O16

GRGASSNYVRL

C46H75N13O16

SDYLQLART

C43H70N12O14

GVDSSFVRL

C46H77N15O13

ADYLRLARA

C49H72N12O13

GPETAFFRL

C37H61N11O10

AQSFVRL

C50H76N14O18

PASDSGFLRDP

C73H114N22O26

SPVPEDDRGDNFVRL

C42H68N12O13

ADYLQLAR

C46H76N16O13

GRADNFLRL

C90H144N28O23

SPAPANKVPHSAANLPLRF

C63H105N19O17

TLSRVPSLPQRF

C55H84N14O18

PVPDSSFLRDP

C60H93N17O18S

SLNTKNDFMRF

C44H68N12O9S2

GGKMFMRF