Product Name

Molecular Formula

Sequence

C58H90N16O13S2

H-CMPLHSRVPFP-OH

C57H90N20O8

H-RIWVIWRR-NH2

C78H121N21O20

Pyr-LYENKPRRPYIL-OH

C70H126N30O20

H-SGRGKGGKGLGKGGAKRH-OH

C132H229N39O26

H-KKALLAHALHLLALLALHLAHALKKA-NH2

C136H215N33O45

H-WEAALAEALAEALAEHLAEALAEALEALAA-OH

KLT

C92H143N21O23

H-KLTWQELYQLKYKGI-OH

C42H76N12O13S

H-CQAASIKVAV-OH

Q11

C68H96N18O20

H-QQKFQFQFEQQ-OH

C93H127N25O26S3

H-CDDYYYGFGCNKFCRPR-OH

C90H127N27O12

H-ILRWPWWPWRRK-NH2

C144H222N44O44S3

H-YTIWMPENPRPGTPCDIFTNSRGKRASNGC-OH

C61H99N15O21S

H-CPPPPEKEKEKE-OH

C65H92N18O27

Ac-YQQYQDATADEQG-NH2

KSL

C63H108N16O10

H-KKVVFKVKFK-NH2

C65H106N18O22

H-YEALRVANEVTLN-OH

VPM

C63H109N25O22S4

H-GCRDVPMSMRGGDRCG-OH

C119H201N49O29S

H-DTRLNTVWMWGGRRRQRRKKRG-OH, all D-type

C292H451N83O84S

H-APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS-OH

C56H96N26O13S

H-GRRRRSVQWCA-NH2

QQM

C73H113N19O21

H-KYNDRLPLYISNP-OH

C164H251N57O45

H-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH

C66H128N16O11

H-KLKLLLLLKLK-NH2

C54H85N11O13

H-VYLKTNVFL-OH

C18H32N8O9S

H-CRGDS-OH

C25H42N10O11S

H-GRGDSPC-OH

C144H248N54O35S

H-WEARLARALARALARHLARALARALRACEA-OH

7A

C28H43N9O11S

H-MHSPGAD-OH

C36H66N10O13S3

H-CSTSMLKAC-OH

C57H83N17O17

H-RNPNDKYEPF-NH2

C74H93N21O18

H-AWSATWSNYWRH-OH

C42H52N8O10

H-FGFPAFSG-OH

C45H76N16O10

H-PRSFLLRN-NH2

C212H314N54O66S3

H-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC-OH

C61H100N16O20

H-GSETWKTIITKN-OH

C33H60N10O8S

H-LCLRPVG-OH

C255H382N70O45

H-RFRPPIRRPPIRPPFYPPFRPPIRPPIFPPIRPPFRPPLGPFP-OH

C133H225N51O25

H-RRIRPRPPRLPRPRPRPLPFPRPG-OH

C84H130N20O15

H-KFAKFAKKFAKFAK-OH

C59H110N24O16S2

H-KCVRQNNKRVCK-OH