NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C181H307N69O38S

H-RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF-OH

C191H325N67O52

H-APKVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRNQG-Amidation

LFB

C145H252N40O42S2

H-GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC-OH

C103H155N29O17

H-AKKKLSRWWLRWWVK-OH

C113H190N34O21

H-LVIRWVRAGYKLYRAIKKK-Amidation

C126H186N46O21

H-IHHIHHIIHHIHHIIHHIHHI-Amidation

C85H134N30O13

H-WRLRWKTRWRLK-Amidation

C128H231N49O25

H-IARRALKKAKRAAHKIPAAKKFARR-Amidation

C67H106N16O19

H-VALTGLTVAEYFR-OH

C175H291N65O38

H-TRGRWGRFKRRAGRFIRRNRWQIISTGLKLIG-OH

C187H308N50O34

H-KRFKKFFRKIKKGFRKIFKKTKIFIGGTIPI-OH

C53H79N15O18

H-VAEARQGSFSY-OH

C121H206N34O28S

H-GLWSKIKKAAKTAGKAALGFVNKMV-Amidation

C143H244N40O38S

H-ALWKTMLKKLGTVALHAGKAALGAVADTISQ-Amidation

C140H217N45O32

H-SNVYRPPPYRPVYRPLRRPGYRPGK-OH

C150H276N50O37

H-SQRKLAAKLTSKGGGRLLRPLLQLLKQKLR-OH

C68H113N25O11

H-AARIILRWRFR-Amidation

C90H159N25O16

H-LLLFLLKKRKKRKY-OH

C40H68N16O12S2

H-ATCYCRTGR-Amidation

C114H192N28O23

H-FLKAIKKFGKEFKKIGAKLK-OH

C137H229N37O30

Acetylation-IWLTALKFLGKNLGKHLAKQQLAKL-Amidation

C118H203N29O27S2

H-FLPILAGLAANLVPKLICSITKKC-Amidation

C109H177N37O24

VDKPPYLPRPRPPRrIYNr-NH2 (r=D-Arg)

gu-ONNRPVYIPRPRPPHPR-OH (Gu = N,N,N’,N’-tetramethylGuanidino and O = L-ornithine)

C141H240N40O38S

H-ALWKTMLKKLGTVALHAGKAALGAAADTISQ-Amidation

C183H285N51O51S2

c(CAWGLAILEGELAWLEGGGGGGGQLADLKRQLAWLKQAC)

C115H194N40O38S

H-GRTSKQELCTWERGSVRQADKTIAG-Amidation

C20H19N3O3

Cyclo-(D-Trp-Tyr)

C102H182N28O24

H-GIFSKLAGKKIKNLLISGLKG-Amidation

C202H293N59O46S2

H-WEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC-OH

C100H168N30O33S

Acetylation-CIRFVSIDNKKRNIESSEIG-OH

C78H106N18O9

K-K-W-W-K-K-W-Dip-K-NH2

C88H144N20O24S

H-TFLILMAALTATFASAQK-OH

C109H177N37O24

H-VDKPPYLPRPRPPRrIYNr-Amidation

C49H57N9O10

Nap-GFFKEH

C50H74N18O15

H-RNAENFDRF-Amidation

C115H185N43O29

H-YGRKKRRQRRRYKEGYNVYG-OH

C81H104N20O33

Acetylation-DDSDVWWGGADTDYADG-Amidation

C234H372N60O76S4

H-DKEMAATSAAIEDAVRRIEDMMNQYPYDVPDYAMDFSGLSLIKLKKQ-OH

C238H367N79O75S

H-MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW-OH