Product Name

Molecular Formula

Sequence

C44H72N12O16

H-SETYELRK-OH

P15

C59H100N20O19

H-GTPGPQGIAGQRGVV-OH

C78H111N21O19

Ac-SYS-{Nle}-EH-{d-Phe}-RWGKPV-NH2

C30H44N8O6

H-YrFK-OH

C152H229N41O50

H-HADGTYTVDVSTYLQDQAAKDFVSWLKSGRA-OH

C169H280N62O43

H-RKKRRQRRRFNAPFDVGIKLSGVQYQQHSQAL-NH2

C215H347N61O65S

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

C44H68N14O11

H-tkwGhvnk-OH

GCF

C14H19N3O4S

H-GCF-OH

C36H61N9O8

H-VQIVYK-NH2

A7R

C40H61N11O9

H-ATWLPPR-OH

C11H14N4O2

cyclo(HP)

C133H217N43O43

H-HSDGTFTSEYSRLRDSARLQRLLQGLV-OH

C242H380N76O76S5

H-YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-OH

C152H243N47O44S4

Pyroglutamic acid Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: Cys6-Cys12, Cys7-Cys14)

C57H70N12O9S2

H-fCYwKVCW-NH2, disulfide bond: Cys2-Cys7

C49H64N10O11S2

H-fCFwKTCT-OH, disulfide bond: Cys2-Cys7

C157H252N36O47

H-GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE-OH

C82H124N24O27S2

H-C*YYDNSSSVLC*KRYRS-OH

H-TFFYGGSRGKRNNFKTEEYK(N3)-OH

C119H206N32O35

H-SALLRSIPAPAGASRLLLLTGEIDLP-OH

C58H73N13O21S2

Pyr-QD-Y(SO3H)-TGWMDF-NH2

C36H51N9O7

H-GPPPGLW-NH2

C144H248N54O34

H-GRKKRRQRRRPQRWEKISIINFEKL-OH

C19H30N6O11S

H-DGEAGC-OH

C44H67N13O12

H-GPQGIWGQK-OH

C55H94N14O14S

H-MASLIYRQLL-OH

C63H121N23O19

H-STSTTAKRKKRKL-OH

C23H30N6O7

Glutaryl-GR-AMC

C22H39N7O8S

H-CSPGAK-OH

C48H71N11O5

Palmitoyl-HFRW-NH2

C123H176N30O58

H-DYKDDDDKDYKDDDDKDYKDDDDK-OH

C147H211N47O42

H-GFWGGLGYIAGRVGAAYGHAQASANNHHSPING-OH

C149H243N53O39S

H-RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG-OH

C182H275N55O48S

H-GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR-OH

C188H293N53O44S

H-PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG-OH

C91H161N33O19

H-RAGLQFPVGRLLRRLLR-OH

C82H152N40O23

H-GRRRQRRKKRGGPGSGGSL-OH (All D-amino acids)

C41H58N12O9

H-SFHFGRL-OH

C71H126N26O12

H-VRLIVAVRIWRR-NH2