NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C72H138N20O15

H-KLAKLAKKLAKLAK-OH (All D-type amino acid)

PL3

C36H69N17O9

H-AGRGRLVR-OH

C31H59N15O10S

H-CGNKRTR-OH

C104H168N34O20S

H-RQIKIWFQNRRMKWKK-OH

C67H124N34O14S

H-CYGRKKRRQRRR-Amidation

UNO

C36H66N14O10S2

H-CSPGAKVRC-Amidation

C75H97N17O19

H-YHWYGYTPQNVI-OH

C36H65N17O12S2

H-CGNKRTRGC-OH

C44H82N20O13S2

H-CRKRLDRNC-OH

C71H99N19O15S

H-THRPPMWSPVWP-OH

C116H207N43O24S2

H-MVRRFLVTLRIRRACGPPRVRV-OH

C97H124N20O31S

Pyr-GPWLEEEEEAYGWMDF-NH2

C101H164N24O28S

H-GPTHLFQPSLVLDMAKVLLD-OH

C53H67N9O17

H-YPYDVPDYA-OH

C151H222N44O40S6

H-DCYCRIPACIAGERRYGTCIYQGRLWAFCC-OH(Disulfide bridge: 2-30,4-19,9-29)

C156H228N46O46S7

H-AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH(Disulfide bonds between Cys4- Cys31, Cys6- Cys20, and Cys10- Cys30)

C188H305N55O50S6

H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (Disulfide bonds between Cys8-Cys37, Cys15-Cys28, and Cys20-Cys38)

C180H295N63O52S6

H-ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK-OH(Disulfide bonds between Cys6-Cys33, Cys13-Cys27, and Cys17-Cys34)

C167H256N48O50S6

H-DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH(Disulfide bridge: 5-34, 12-27, 17-35)

C150H222N44O38S6

H-ACYCRIPACIAGERRYGTCIYQGRLWAFCC-OH(Disulfide bridge: 2-30, 4-19, 9-29)

C147H217N43O37S6

H-CYCRIPACIAGERRYGTCIYQGRLWAFCC-OH(Disulfide bonds between 1-29 3-18 8-28)

C216H371N75O59S6

H-GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK-OH
(Disulfide bridge: 11-40, 18-33, 23-41)

C65H126N18O12

H-GIKAKIIIKIKK-Amidation

C32H49N9O5

D-Arg-Dmt-Lys-Phe-NH2

C203H311N55O60S

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

C199H323N61O47S

H-TFFRLFNRSFTQALGKGGGKNLRIIRKGIHIIKKYGGGC-OH

C107H154N30O32S

H-TFFYGGSRGKRNNFKTEEYC-OH

C94H140N24O26S

ffGGreGcvlylaevlhsG (lower case letters on behalf of D-amino acid)

C32H57N9O11S

H-CGLSGLGVA-OH

C194H320N64O49S

DRQIKIWFQNRRMKWKKeqlydllkGarkrsstr (lower case letters are on behalf of D-amino acid)

C184H313N53O46

H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

C183H314N56O44

H-RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2

C74H123N21O14

H-RWKIFKKIEKVG-NH2

C83H133N23O12

H-RWKIFKKVVKKW-NH2

C124H192N36O21

H-kwllrwlsrllrwlarwlg-OH(All D-type amino acids)

C79H117N21O25S

H-DHVTPDIAYNPRTMY-OH

C117H201N49O23

Ac-rGffvlkGrrrrqrrkkrGy-NH2 (all D-amino acids)

C161H290N50O28

IRPIIRPIIRPIIRPIIRPIIRPIIRPI-NH2 (amidation)

C96H170N40O22

H-GRRRQRRKKRGGTFLGPPL-OH (All D-amino acids)

C93H166N40O23

H-GRRRQRRKKRGGPLSGFSL-OH