Product Name

Molecular Formula

Sequence

C42H84N28O7

cyclo[RRRRRRR]

C102H186N26O20

H-FAKKLAKLKKKLAKLALAL-OH

C59H75N13O20S3

Pyr-QDY(SO3H)MGWMDF-NH2

C194H312N54O59S2

{Eicosanedioic-acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:C3-C8)

RY4

C30H44N8O7

H-rYKY-OH

C35H65N15O7

H-RKVRGPP-NH2

C35H65N15O7

H-RKVRGPP-NH2

C103H169N43O27

H-GRYRSPYDRRRRYRRITD-NH2

C85H146N26O21

H-EARPALLTSRLRFIPK-OH

C22H39N9O5

Ac-KGHK-NH2

C107H171N39O29

H-TFYGGRPKRNNFLRGIRSRGD-OH

C86H130N24O25S

H-YTIWCDIFTDSRQKR-OH

C168H243N53O53S

H-NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY-OH

C104H169N35O19S

H-RQIKIWFQNRRMKWKK-NH2

C104H183N23O24S

H-MAIVGTIIKIIKAIIDIFAK-OH

C109H185N25O25S

H-MGIIAGIIKFIKGLIEKFTGK-OH

C138H197N43O33S

YGRKKRRQRRRITQVYGFYD-FITC

RAP

C60H83N19O17

H-YWDHNNPQIR-OH

C68H94N20O11

H-RWKFGGFKWR-OH

C44H72N12O16

H-SETYELRK-OH

P15

C59H100N20O19

H-GTPGPQGIAGQRGVV-OH

C78H111N21O19

Ac-SYS-{Nle}-EH-{d-Phe}-RWGKPV-NH2

C30H44N8O6

H-YrFK-OH

C152H229N41O50

H-HADGTYTVDVSTYLQDQAAKDFVSWLKSGRA-OH

C169H280N62O43

H-RKKRRQRRRFNAPFDVGIKLSGVQYQQHSQAL-NH2

C215H347N61O65S

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

C44H68N14O11

H-tkwGhvnk-OH

GCF

C14H19N3O4S

H-GCF-OH

C36H61N9O8

H-VQIVYK-NH2

A7R

C40H61N11O9

H-ATWLPPR-OH

C11H14N4O2

cyclo(HP)

C133H217N43O43

H-HSDGTFTSEYSRLRDSARLQRLLQGLV-OH

C242H380N76O76S5

H-YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-OH

C152H243N47O44S4

Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: Cys6-Cys12, Cys7-Cys14)

C57H70N12O9S2

H-fCYwKVCW-NH2, disulfide bond: Cys2-Cys7

C49H64N10O11S2

H-fCFwKTCT-OH, disulfide bond: Cys2-Cys7

C157H252N36O47

H-GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE-OH

C82H124N24O27S2

H-CYYDNSSSVLCKRYRS-OH, (Cys1-Cys11 disulfide bond)

H-TFFYGGSRGKRNNFKTEEYK(N3)-OH

C119H206N32O35

H-SALLRSIPAPAGASRLLLLTGEIDLP-OH