Product Name

Molecular Formula

Sequence

C68H106N16O10

H-KKVVFWVKFK-NH2

C263H416N74O76S3

Biotin-AGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE-OH

C45H80N10O14

H-ELAGIGILTV-OH

C45H82N14O12

H-RLQGISPKI-OH

WH

C73H96N22O16

H-WPRFHSSVFHTH-OH

C52H76N14O17

H-FLYDDNQRV-OH

C60H94N14O16

H-YLGYLEQLLR-OH

C51H84N12O14

H-RLVDDFLLV-OH

C196H293N45O58S

H-AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG-OH

C39H62N10O15S

H-AYACNTSTL-OH

C53H85N23O13

H-HNIRGRWTGR-OH

C44H78N12O13S2

H-GIVCPICSQK-OH

C59H97N13O11S

H-YLMFLLRKI-OH

C49H84N14O15

H-NAVAAANLPGLV-OH

C51H73N13O15S

Biotin-fYIGSRGD-OH, f=D-phenylalanine

C35H59N13O14S2

c(CRGDKGPDC) (Disulfide bridge:Cys1-Cys9)

C61H76N24O13S

Biotin-GGFGHHHHHH-OH

C77H107N23O10S

H-CKRWWKWIRW-NH2

C27H49N9O9

H-LDLQR-OH

C39H71N13O12S

H-CAAAAKAAAAK-OH

C44H58N8O10S2

H-CFEFKFC-OH

C145H241N43O49S2

H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-OH

C32H53N9O7S

H-FCIGRL-OH

C78H120N24O22

H-AREYGTRFSLIGGYR-OH

C156H243N65O24

H-FWQRRIRRWRRFWQRRIRRWRR-NH2

C143H228N52O29

H-FQWQRNIRKVRPRVKRINRQWQF-NH2

C49H70N10O14

H-QYDPVAALF-OH

C104H176N38O36S

Biotin-RPSSRASSRASSRPRPDDLEI-OH

C194H290N44O57S

H-AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTC-OH

Rb9

C83H123N27O24S2

H-CARGETARATFAYWGQGC-NH2

C27H39N9O9

Suc-AAPR-pNA

C49H57N13O6

Fmoc-WWRR-NH2

C50H76N16O15

H-GGGPQGIWGQGK-OH

C150H238N48O34

H-RQPKIWFPNRRKPWKKRPRPDDLEI-OH

C42H73N9O11

H-ALLPAVPSL-OH

C39H71N9O11S2

H-CLGGLLTMV-OH

C122H204N32O25

H-WFGKLYRGITKVVKKVKGLLKG-OH

C66H106N16O29

H-REIEEEPLSEDLE-OH

NLS

C32H65N19O7

H-KRRRRG-OH

C42H64N10O15S

H-TAPDNLGYM-OH