Product Name

Molecular Formula

Sequence

C42H77N9O11S

H-LLMGTLGIV-OH

C51H79N11O16S

H-TLHEYMLDL-OH

C50H84N10O12S

H-KVVEFLAML-OH

C48H73N15O14

H-GGGPQGIWGQK-OH

C56H99N21O18S2

H-CRHSQMTVTSRL-OH

C42H72N12O13

H-GLSNLTHVL-OH

C51H82N12O12

H-KVAELVHFL-OH

C72H119N21O26

H-NVIQAPAQSVAPPNTST-OH

C45H80N10O14

H-ELAGIGILTV-OH

C53H82N16O19

H-HEVPSGPNPISN-OH

C78H147N21O22

H-KKSLSLSLSLSLSLKK-NH2

C49H87N15O12

H-KVLEHVVRV-OH

C49H79N11O13S2

H-SLLMWITQC-OH

C32H50N10O9S

Ac-RFAACAA-OH

C21H37N9O5

H-GPRPA-NH2

C78H106N18O9

KKWWKKW-Dip-K-NH2

C39H63N11O11

H-IALDFQR-OH

P5

C41H71N13O15

H-LQLQAEER-OH

C50H77N13O17

H-TDHGAEIVYK-OH

C53H84N16O18

H-GFQALGDAADIR-OH

C41H59N11O9

H-FGPGVAFR-OH

C40H73N9O11S2

H-GLCTLVAML-OH

C61H77N13O13

H-HLFGYSWYK-OH

C83H101N17O20

H-YEQDPWGVKWWY-OH

C50H67N9O15S2

H-CLSYYPSYC-OH

C32H53N9O7S

H-FCIGRL-OH

C52H74N16O15S2

H-GGGCYFQNCPKG-NH2, disulfide bridge: Cys4-Cys9

C215H358N72O66S

H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

C98H152N32O17S

H-KRLFRRWQWRMKKY-OH

C60H94N14O16

H-YLGYLEQLLR-OH

DP1

C46H77N13O16S

H-DEHGTAVMLK-OH

VPV

C15H27N3O4

H-VPV-OH

C53H73N11O14

H-YPFPGPIPNS-OH

C130H183N33O51S2

Biotin-MDYKDHDGDYKDHDIDYKDDDDK-OH

C51H74N12O22S

Biotin-DYKDDDDK-OH

C70H100N14O15

H-KFEFKFEFKK-OH

C39H58N14O9S

H-WQRHGIC-OH

C49H75N13O13S

H-GMKFDRGYI-OH