pTH (1-34), Parathyroid Hormone (1-34), human peptide

pTH (1-34), Parathyroid Hormone (1-34), human peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

34

97.5%

C₁₈₁H₂₉₁N₅₅O₅₁S₂

4117.77

52232-67-4

Synthetic

Powder

This peptide consisting of the N-terminal 34 amino acid residues of pTH shows the same potency and pharmacological profile as the native hormone. Administration of pTH (1-34) stimulates bone formation and increases the bone mineral density (BMD).For our monoclonal antibody to pTH (1-34) (human), please see T-0012. Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• S.H.Doppelt et al., Calcif. Tissue Int., 33, 649 (1981)
• R.Podbesek et al., Endocrinology, 112, 1000 (1983)
• G.N.Kent et al., Clin. Sci., 68, 171 (1985)
• S.C.Lee and A.F.Russell, Biopolymers, 28, 1115 (1989)
• R.L.McKee and M.P.Caulfield, Pept. Res., 2, 161 (1989)
• J.Reeve et al., Br. Med. J., 301, 314 (1990)
• W.Neugebauer et al., Int. J. Peptide Protein Res., 43, 555 (1994)
• G.J.Pettway et al., Bone, 36, 959 (2005)

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.