New Articles List

Terrific Broth (TB)12 g/L tryptone (1.2% m/V)24 g/L yeast extract (2.4% m/V)4 mL/L glycerol (4.34 mM, 0.4% V/V)17 mM KH2PO4, 2.31 g/L72 mM K2HPO4, 12.54 g/L(opt.) 15 g/L agar (1.5% m/V)(opt., nontrad.) 5–10 mM 1 M MgSO4  or MgCl2The original sug...

mScarlet3 is a type of red fluorescent protein that has been developed by researchers to label specific structures and organelles in cells. It is a monomeric protein, which means that it exists as a single molecule rather than forming aggregates. The...

For producing lentiviral particles you typically need three components: 1) a lentiviral vector, such as pLKO.1 or pLVTHM or pLVX-PURO, containing the shRNA or transgene, 2) a packaging vector, such as psPAX2 or pCMV-dR8.2 dvpr and 3) an envelop vecto...

INCI Name Sequence CAS Molecular Formula Tripeptide-10 Citrulline H-Lys-Asp-Ile-Cit-NH2 960531-53-7 C22H42N8O7 Palmitoyl Tripeptide-5 palmitoyl-Lys-Val-Lys-OH 623172-56-5 C33H65N5O5 Acetyl Tetrapeptide-11 Ac-Pro-Pro-Tyr-Leu-OH 928006-88-6 C27H38N4O7...

(1) CyclizationHead-to-tail cyclic, stapled peptide, side chain cyclic, multiple disulfide-bonds cyclic (Sec&Sec), monothioether cyclic, click chemistry, Cyclization via xylene or mesitylene(2) Isotopic labeling13C, 15N modified R or K (D type or...

Cyclisation Cyclisation techniques have been used widely in the peptide field and achieved in several ways from cyclising head to tail, head/tail to side chain or side chain to side chain. A type of side chain to side chain cyclisation is called sta...

Human elongation factor-1 alpha (EF-1 alpha) is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts. EF-1 alpha is often useful in conditions where other promoters (such a...

>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQ...

Jeff Lawrence (Z51)(NOTE: This section describes classic green plates, which have now been superceded by "Mint Green Plates")Plate Mix 828 g Bacto-Tryptone (Difco) 105 g Yeast Extract (Difco) 516 g NaCl 1551&nb...

ProtocolModification of Jeff Lawrence (X10)1. Prepare media in two flasks: Flask A 12 g Agar 4 g Tryptone 4 g Yeast Extract 40 mg Anhydrotetracycline  400 mL Water Flask B 8 g NaCl 8 g NaH2PO4 40...