New Articles List

Cosmetic Peptides

INCI Name Sequence CAS Molecular Formula Tripeptide-10 Citrulline H-Lys-Asp-Ile-Cit-NH2 960531-53-7 C22H42N8O7 Palmitoyl Tripeptide-5 palmitoyl-Lys-Val-Lys-OH 623172-56-5 C33H65N5O5 Acetyl Tetrapeptide-11 Ac-Pro-Pro-Tyr-Leu-OH 928006-88-6 C27H38N4O7...

View More

Peptide Modifications

(1) CyclizationHead-to-tail cyclic, stapled peptide, side chain cyclic, multiple disulfide-bonds cyclic (Sec&Sec), monothioether cyclic, click chemistry, Cyclization via xylene or mesitylene(2) Isotopic labeling13C, 15N modified R or K (D type or...

View More

Difference between EF-1 alpha and the CMV promoter

Human elongation factor-1 alpha (EF-1 alpha) is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts. EF-1 alpha is often useful in conditions where other promoters (such a...

View More

Mouse, human and rabbit Fc tag sequences

>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQ...

View More

Green Indicator Plates

Jeff Lawrence (Z51)(NOTE: This section describes classic green plates, which have now been superceded by "Mint Green Plates")Plate Mix 828 g Bacto-Tryptone (Difco) 105 g Yeast Extract (Difco) 516 g NaCl 1551&nb...

View More

Amino Acid Stock Solutions

Amino acid Stock Concentration Molecular Weight gm/100ml ml/liter ml/plate Arginine 50mM 100mM 210.7 1.054 2.107 10 5 0.2 0.1 Asparagine 300 mM 132.1 7.926 10 0.2 Histidine HCl 100 mM 209 2.09 3 0.1 Isoleucine 50 mM 131.2 0.656 10 0.2 Leucine 100 mM...

View More

50X E Salts and Derivatives

Jeff Lawrence (Z50)50X E Salts1. Heat 1 L distilled water in a 4 liter beaker.2. Dissolve completely, in indicated order: 300 g citric acid monohydrate (H3C6H5O7·H2O)  14.1 g MgSO4  1965 g K2HPO4·3H2O 525 ...

View More

Antibiotic Stock Solutions

Antibiotic AbbreviationConcentration1Concentration1Stock Solution2  (Rich Media)(Minimal Media)ml/liter Na Ampicillin3 Amp, Ap 50 μg/ml 15 μg/ml4 20 mg/mL 50% EtOH  Chloramphenicol Cam, Cm 20 μg/...

View More