Product Name

Molecular Formula

Sequence

C12H26N4O2

KL

C71H133N19O15

INLKAIAALVKKVL

C44H71N17O10S2

CFIRNCPRG

AGGLDDLLEPVLNSADNLVHGL

C192H295N61O60S

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

C144H237N39O39S2

ALWKTMLKKLGTMALHAGKAAFGAAADTISQ

GILSTFKGLAKGVAKDLAGNLLDKFKCKITGC

PVNSGRSSGSRFNFGL

C175H284N44O44S2

MERSTRELCLNFTVVLITVILIWLLVRSYQY

C60H89N15O13

YGGFLRKYPK

C159H262N42O43S2

SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC

C21H31N5O7

AAAYA

MTRRARVAPALAPAKCGCTKVAAGYMRMRRWALGGWGA

C177H280N52O55S3

SDSKIGNGCFGFPLDRIGSVSGLGCNRIMQNPPKKFSGE

GLLDFVTGVGKDIFAQLIKQI

C45H68N8O10S

FLVMFLSG

VAPLWIVSTDYDNYAIGYSCK

SSKSISTQAVWVCMVLAVVFQEITSSPA

C149H246N44O42

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu- Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2

C35H49N10O18P1

Trp-Ala-Gly-Gly-Asp-Ala-Ser(PO3H2)-Gly-Glu

C33H57N11O9

TKPRPGP

C64H82N18O13

pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2

C121H200N42O39

PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-D-Arg-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2

C121H200N42O39

YQPPSTNKNTKSQRRKGSTFEEHK

C165H269N47O46

H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Mal)-NH2

C46H56N12O6

H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2

C47H58N12O6

H-His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2

C45H55N9O6

H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2

C38H49N9O5

H-Aib-His-D-2-Nal-D-Phe-Lys-NH2

C14H22N4O9

AEDG

C212H350N56O78S

Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH

C50H69N15O9

Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2

C50H68N14O10

Ac-Nle-cyclo(Asp-His-D-Phe-Arg-Trp-Lys-OH)

C41H70N16O16S

Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2