Product Name

Molecular Formula

Sequence

ALESAKLVPWWIPP

C25H47N5O6S

IIGLM

GFMDTAKNVAKNVAKNVAVTLLDKLRCKVTGGC

C62H106N20O23

GKVNVDEVGGEALGR

C32H47N7O11

ATWLDT

C57H90N18O18S

GAHYMRALSNVE

C53H94N16O18

VLSAADKGNVKAA

C78H117N21O27

FVDSLAGYSKHQDGGIS

GVVDILKGAAKDLAGHLATKVMNKL

C69H118N14O14

FLPIIAKLLGGLL

C135H208N42O39

GWTLNSAGYLLGPHGIDGHRTLSDKHGLA

IPFVASVATEMMHHVYCAASKRC

C82H123N19O27

AFLTLTPGSHVDSYVEA

C100H158N28O36S4

MPSNTQTSNSSMGVNGYSYCVVM

C13H16N2O5

DF

C9H16N4O5

AGGG

C48H72N12O14

GPPDPNKFIG

KVPIGAIKKGGKIIKKGLGVLGAAGTAHEVYNHVRNRQ

C148H231N41O46

HAEGTFTSDVSSKLEGQAAKEFIAWLVKGRG

C61H93N15O13S3

FCTMIPIPRCY

VRLEFKLQQTSCRKRDWKKP

GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH

C100H153N33O30S3

CFGGRMDRIGAQSGLGCNSFRY

C41H57N7O8

LVVYPW

C35H67N17O11

RKRSRAE

C61H86N12O18

FAYDGKDYIAL

YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF

C119H199N31O26

FKVLGSVAKHLLPHVAPIIAEKL

C10H18N2O3S

PM

SGSKTAEIDDGCFGLPLDPIGSTSGMGCRSVPKPIPGGS

C168H321N95O37

PRRRRRSSSRPIRRRRRPRVSRRRRRGGRRRR

GFGSFLGKALKAALKIGANVLGGAPEQ

C101H155N27O23

FLSLIPHAINAVSTLVHHF