• Plantaricin NC8β peptide

Plantaricin NC8β peptide

Not For Human Use, Lab Use Only.

Cat.#: 318810

Special Price 429.90 USD

Availability: 5 working days
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Plantaricin NC8β peptide
  • Documents
  • Sequence Shortening
    SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH
  • Sequence
    H-Ser-Val-Pro-Thr-Ser-Val-Tyr-Thr-Leu-Gly-Ile-Lys-Ile-Leu-Trp-Ser-Ala-Tyr-Lys-His-Arg-Lys-Thr-Ile-Glu-Lys-Ser-Phe-Asn-Lys-Gly-Phe-Tyr-His-COOH
  • Length (aa)
    34
  • Peptide Purity (HPLC)
    95.02%
  • Molecular Formula
    C189H289N49O47
  • Molecular Weight
    3999.6
  • Source
    Synthetic
  • Form
    Powder
  • Description
    Bacteriocins are antimicrobial peptides that are produced by most microorganisms that contribute their defence mechanisms. PLNC8 α and PLNC8 β are class II bacteriocins. Both L- and D-PLNC8 αβ caused rapid disruption of lipid membrane integrity and were effective against both susceptible and antibiotic resistant strains. The D-enantiomer was stable against proteolytic degradation by trypsin compared to the L-enantiomer. Of the truncated peptides, β1–22, β7–34 and β1–20 retained an inhibitory activity. The peptides diffused rapidly (2 min) through the bacterial cell wall and permeabilized the cell membrane, causing swelling with a disorganized peptidoglycan layer. Interestingly, sub-MIC concentrations of PLNC8 αβ substantially enhanced the effects of different antibiotics in an additive or synergistic manner. PLNC8 αβ is active against Staphylococcus spp. and may be developed as adjuvant in combination therapy to potentiate the effects of antibiotics and reduce their overall use. PLNC8 α and β are short peptides, composed of 29 and 34 amino acids, respectively, and show structural stability against heat and pH. Both PLNC8 α and β are membrane active on their own, but whereas more than 5 μM of PLNC8 α was required to induce substantial perturbation of lipid bilayer integrity in a liposomal model system, less than 0.1 μM PLNC8 β caused the same effects.
  • Storage Guidelines
    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • References
    • Bengtsson, T. et al. (2020) Plantaricin NC8 alpha-beta exerts potent antimicrobial activity against Staphylococcus spp. and enhances the effects of antibiotics. Scientific Reports. doi.org/10.1038/s41598-020-60570-w.
  • About TFA salt

    Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

    Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

    Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

    In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight

Peptide Property

  • Analysed Sequence:H-SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH-OH
  • Chemical Formula:C189H288N48O48
  • Sequence length:34
  • Extinction coefficient:9530 M-1cm-1
  • GRAVY:-0.38
  • Mw average:4000.58
  • Theoretical pI:10.36
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

X: Hydrophobic uncharged residues, like F I L M V W A and P

X: Basic residues, like R K H

X: Acidic residues, like D E

X: Polar uncharged residues, like G S T C N Q and Y

• Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

• Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

• Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"