NovoPro
Cart 2
  • Anti-IL-1 beta Rabbit antibody
  • Anti-IL-1 beta Rabbit antibody

Anti-IL-1 beta Rabbit antibody

Cat.#: 169102

Size:

Special Price 441.3 USD

Availability: In Stock
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Anti-IL-1 beta Rabbit antibody
  • Documents
  • Description
    IL-1 beta Rabbit polyclonal antibody
  • Tested applications
    WB
  • Species reactivity
    Human, Mouse, Rat
  • Isotype
    Rabbit IgG
  • Preparation
    Antigen: Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
  • Clonality
    Polyclonal antibody
  • Formulation
    PBS with 0.02% sodium azide,50% glycerol,pH7.3.
  • Storage instructions
    Store at -20°C . Avoid freeze / thaw cycles.
  • Applications

    WB: 1/500 - 1/2000

  • Validations

    Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody .Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.

    Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody .Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.

    Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 10s.

    Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 10s.

  • Background
    Swiss-Prot Acc.P01584.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
  • References

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"