Product Name

Molecular Formula

Sequence

C32H48N6O10

DSPLFV

C57H81N19O19

HDSGYEVHHQK

C51H81N9O18

EYILSLEEL

C55H84N16O17

AGSDGRLYSFGL

C75H120N20O23

VLGAFSDGLAHLDNLK

C9H15N3O4

GGP

JGPWLEEEEAYGWMDF

C192H278N50O58

APSEPQHPGDQATPDQLAQYYSDLYQYITFITRPRF

C135H209N41O38

SPEELSRYYASLRHYLNLVTRQRY

C30H44N8O4

FLRF

ALWKNMLKGIGKLAGKAALGAVK

C55H81N11O11

APFIFPGPKV

C85H145N21O22

GLFDIIKKVASVVGLASP

C184H290N52O52S

YGGFMKSWDERGQKPLLTLFRNVIVKDGHEKKTQS

C200H322N60O64

FIPINNRLSDVLQSLEEERLRDSLLQDFFDRVAGRDGSAV

C46H69N13O11

APTAFYGVR

FTMKKSPLLLFFLGTISLSLC

GIFPIFAKLLGKVIKVASSLISKGRTE

MKLNGGKSLDPTGLY

C45H69N13O10

KNEFIRF

C42H76N16O13

ARVAEQLRA

C48H66N10O12

YSKFNFGL

GLMDTVKNAAKNLAGQLLDRLKCKITGC

C89H135N25O25

VHHQKLVFFAEDVGSNK

C178H258N64O48

DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

C35H57N15O6

HLRGRF

C47H72N14O11

APRLRFYS

C61H89N15O18S

AQDFVQWLMNT

C107H160N28O30

AYTYTNGGNGIKRLPVYNFGL

C48H85N19O14S

AARAGPNLMRE

C40H59N11O11

RQYSFGL

SALVGCWTKSWPPKPCFGR

GILDTLKHLAKTAGKGALQSLLNHASCKLSGQC