Product Name

Molecular Formula

Sequence

C138H206N38O31

GWKKWFNRAKKVGYTVGGLAVDHYL

C131H229N37O31

GIGAILKVLATGLPTLISWIKNKRKQ

GRHDYVASPPPPKPQDEQRQ

C33H53N9O8S

RSPMFV

C85H125N23O32

NEVPDPETERNSYDFGL

C89H130N24O24

AGEGLSSPFWSLAAPQRF

RPPGFSPFRIY

C47H74N12O15

YGEPKLDAGV

C58H81N17O16

HHPTEFTPAVH

FLPILGKLLSGFL

C20H21N3O3

WF

C39H61N11O12S2

CYITNCGLG

C20H33N7O9

GQSPQ

AAASDNFMRF

DP1

RRQRRTSKLMKRGGKLAKLAKKLAKLAK

AGGLLDFGLSRGASGAEAAKARLGLKLANDPYGP

C12H18N6O5

GGHG

C75H128N24O23S2

RSAQGMGKMERLLASY

C41H59N9O13S

SDMYSFGL

MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

C37H47N7O10

YPWVAD

YAFEVVG

C109H167N33O20

FFRLLFHGVHHVGKIKPRA

C119H204N34O32S2

MAPRGFSCLLLLTSEIDLPVKRRA

DWEAAPGQIWSMAVPQRF

C15H22N2O3

LF

C77H129N23O25

ASFEAQKAKANKAVDKA

C37H54N10O9

SFFLRN

C21H33N3O4

LLF

GIGALSAKGALKGLAKGLAEHFAN

C187H289N51O52

RIAPVFPGKDASVDELAKFYTELQQYLNSINRPRF

GSGTKVGGAGAATKVVTKSGS

C56H94N20O23

QKSQRSQDENPV

C57H96N14O17S

TLTTGKDFVGLM

C164H254N46O33S

GFFGKMKEYFKKFGASFKRRFANLKKRL

C57H94N18O18

GDGRHDLLVGAPL