NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C9H14N4O4

HS

FLSTALKVAANVVPTLFCKITKKC

LPAAFRLAAKIVPTVFCAISKKC

C141H227N51O42S2

GPRSLRRSSCFGGRIDRIGAQSGLGCNSFRY

SGSKIGNGCFGLPLDRISNTSGMGCRNPIQNRPKSTPGGS

C44H74N12O10

AARAVFLAL

C41H59N11O12

ARGYDFGL

C145H233N45O45S3

CSGLSTCALMKLSQDLHRFNSYPRTNVGAGTP

C202H318N62O58S3

YIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF

C26H45N5O10

EILDV

C72H104N22O17S

SMEHFRWGKPIGH

RPVKVYPNVAENESAEAFPL

C97H145N27O39

HYYDDTDEEERIVSTVDAR

APVLQIKKTGSN

PVFPGNGDEQPLTENPR

C32H53N9O7

EFLRI

C57H93N21O16S2

CYIQNCPRGGKR

C98H120N16O34S2

CDLIYYDYEEDYYFDC

C44H68N14O10S

YGGFMRRV

C39H60N8O13

VAYEAPSL

C81H153N27O19

KKKGSVVIVGRIILSGR

C29H40N6O6

YAFGL

C59H87N15O13

JLWPRPQIPP

C186H287N53O56S2

APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY

C144H217N41O40S2

SVDPPNNIPLRERKAGCKNFYWKGFTSC

C70H107N17O26

LDLTPGSHVDSYVEA

GPPYQPLVPR

C53H82N14O12

KLHLYSHPI

C49H74N14O11S

VPASGFFGMR

FVVGVLTK

SVMGTVKDLLIGAGKSAAQSVLKALSCKLSKDC