Product Name

Molecular Formula

Sequence

C35H67N17O11

RKRSRAE

YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF

C119H199N31O26

FKVLGSVAKHLLPHVAPIIAEKL

C10H18N2O3S

PM

SGSKTAEIDDGCFGLPLDPIGSTSGMGCRSVPKPIPGGS

C168H321N95O37

PRRRRRSSSRPIRRRRRPRVSRRRRRGGRRRR

C120H196N32O33

H-GFGSFLGKALKAALKIGANVLGGAPEQ-OH

C101H155N27O23

FLSLIPHAINAVSTLVHHF

C46H70N10O10

H-KLPYSFGL-NH2

C12H26N4O2

KL

C71H133N19O15

INLKAIAALVKKVL

C44H71N17O10S2

CFIRNCPRG

C97H158N26O34

H-AGGLDDLLEPVLNSADNLVHGL-OH

C192H295N61O60S

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

C144H237N39O39S2

ALWKTMLKKLGTMALHAGKAAFGAAADTISQ

GILSTFKGLAKGVAKDLAGNLLDKFKCKITGC

C175H284N44O44S2

MERSTRELCLNFTVVLITVILIWLLVRSYQY

C60H89N15O13

YGGFLRKYPK

C159H262N42O43S2

SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC

C21H31N5O7

AAAYA

MTRRARVAPALAPAKCGCTKVAAGYMRMRRWALGGWGA

C177H280N52O55S3

SDSKIGNGCFGFPLDRIGSVSGLGCNRIMQNPPKKFSGE

C107H176N26O28

H-GLLDFVTGVGKDIFAQLIKQI-NH2

C45H68N8O10S

FLVMFLSG

VAPLWIVSTDYDNYAIGYSCK

SSKSISTQAVWVCMVLAVVFQEITSSPA

C149H246N44O42

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

C35H49N10O18P1

WAGGDASGE, S=Phospho Serine

C33H57N11O9

TKPRPGP

C64H82N18O13

pGlu-HWSYwLRPG-NH2, w=D-Trp

C121H200N42O39

PEG-Suc-YQPPSTNKNTKSQrrKGSTFEEHK-NH2, r=D-Arg

C121H200N42O39

YQPPSTNKNTKSQRRKGSTFEEHK

C46H56N12O6

H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2