Cart 2
  • RL-37 peptide

RL-37 peptide

For research use only. We do not sell to patients.

Cat.#: 318953

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 316.4 USD

Availability: In Stock
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    RL-37 peptide
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    H-RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS-OH
  • Three letter code
    H-Arg-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Val-Lys-Glu-Lys-Ile-Gly-Gly-Gly-Leu-Lys-Lys-Val-Gly-Gln-Lys-Ile-Lys-Asp-Phe-Leu-Gly-Asn-Leu-Val-Pro-Arg-Thr-Ala-Ser-OH
  • Length (aa)
    37
  • Peptide Purity (HPLC)
    95.01
  • Molecular Formula
    C187H316N56O47
  • Molecular Weight
    4100.84
  • Source
    Synthetic
  • Additional Information
    RL-37 is an antimicrobial peptide and was found in the Rhesus monkey. Macaque and leaf-eating monkey RL-37 peptides, like other helical antimicrobial peptides found in insect, frog, and mammalian species, were unstructured in bulk solution and had a potent, salt and medium independent antimicrobial activity in vitro, which may be the principal function also in vivo. Human LL-37 and the orangutan, hylobates, and callithrix homologues instead showed a salt-dependent structuring and likely aggregation in bulk solution that affected antimicrobial activity and its medium dependence. The two types of peptides differ also in their interaction with host cells. The evolution of these peptides has thus resulted in distinct mechanisms of action that affect the direct antimicrobial activity andmayalso modulate accessory antimicrobial functions due to interactions with host cells.
  • Storage Guidelines
    Ideally RL-37 peptide should be stored in a freezer at or below -9C. RL-37 peptide should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • I. Zelezetsky, A. Pontillo, L. Puzzi et al., “Evolution of the
    • primate cathelicidin: correlation between structural variations
    • and antimicrobial activity,” Journal of Biological Chemistry,
    • vol. 281, no. 29, pp. 19861–19871, 2006
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"