• PYY (human) peptide

PYY (human) peptide

Not For Human Use, Lab Use Only.

Cat.#: 319333

Special Price 428.90 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    PYY (human) peptide
  • Documents
  • Sequence Shortening
    H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
  • Sequence
    H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
  • Length (aa)
    36
  • Peptide Purity (HPLC)
    95.76%
  • Molecular Formula
    C194H295N55O57
  • Molecular Weight
    4309.75
  • CAS No.
    118997-30-1
  • Source
    Synthetic
  • Form
    Powder
  • Description

    Peptide YY (PYY) is a 36-amino acid peptide hormone belonging to the neuropeptide Y (NPY) family. It is primarily localized in enteroendocrine L cells located in the epithelial lining of the ileum, colon, and rectum. These cells possess specialized sensory microvilli that project into the intestinal lumen and respond to luminal stimuli, such as nutrients from a protein-rich meal, by releasing PYY. PYY cells also exhibit a unique basal cytoplasmic process, termed a neuropod, which possesses neuronal-like characteristics and contains elements necessary for synaptic transmission, suggesting multiple modes of action including paracrine, endocrine, and neurocrine signaling.

    PYY exerts several physiological effects within the gastrointestinal tract. It regulates intestinal motility, secretion, and absorption of water and electrolytes. Its functions include delaying gastric emptying, mediating the ileal brake, and inhibiting gastric and pancreatic secretion. PYY acts by binding to specific G-protein-coupled Y receptors (Y1, Y2, Y5) located on epithelial cells and enteric neurons. Furthermore, PYY plays a role in modulating the release of serotonin from enterochromaffin cells, which influences visceral sensitivity and motor functions.

  • Storage Guidelines
    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • References
    • Pierre JF, Peters BM, La Torre D, Sidebottom AM, Tao Y, Zhu X, Cham CM, Wang L, Kambal A, Harris KG, Silva JF, Zaborina O, Alverdy JC, Herzog H, Witchley J, Noble SM, Leone VA, Chang EB. Peptide YY: A Paneth cell antimicrobial peptide that maintains Candida gut commensalism. Science. 2023 Aug 4;381(6657):502-508. doi: 10.1126/science.abq3178. Epub 2023 Aug 3. PMID: 37535745; PMCID: PMC10876062.
    • Ballantyne GH. Peptide YY(1-36) and peptide YY(3-36): Part I. Distribution, release and actions. Obes Surg. 2006;16(5):651-658. doi:10.1381/096089206776944959
    • Lafferty RA, Flatt PR, Irwin N. Established and emerging roles peptide YY (PYY) and exploitation in obesity-diabetes. Curr Opin Endocrinol Diabetes Obes. 2021 Apr 1;28(2):253-261. doi: 10.1097/MED.0000000000000612. PMID: 33395088.
    • El-Salhy M, Hatlebakk JG, Hausken T. Possible role of peptide YY (PYY) in the pathophysiology of irritable bowel syndrome (IBS). Neuropeptides. 2020 Feb;79:101973. doi: 10.1016/j.npep.2019.101973. Epub 2019 Oct 24. PMID: 31727345.
  • About TFA salt

    Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

    Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

    Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

    In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"