Cart 2
  • Lactocin 705

Lactocin 705

For research use only. We do not sell to patients.

Cat.#: 309482

Optional Service: TFA RemovalWhat's this?

Special Price 379.5 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Lactocin 705
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
  • Three letter code
  • Length (aa)
  • Peptide Purity (HPLC)
  • Source
  • Additional Information
    A two chain bacteriocin. Shown is the sequence for chain a. The peptide sequence for chain b is gfwgglgyiagrvgaayghaqasannhhsping. Lactocin 705 has Antimicrobial activity. The source of Lactocin 705 is Lactobacillus casei CRL 705.
  • Storage Guidelines
    Ideally Lactocin 705 should be stored in a freezer at or below -9C. Lactocin 705 should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.