• D6PV (COR-003) peptide

D6PV (COR-003) peptide

Not For Human Use, Lab Use Only.

Cat.#: 319873

Size:

* Buy 1 get 1 free (?)

Special Price 440.90 USD

Availability: 5 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    D6PV (COR-003) peptide
  • Documents
  • Sequence Shortening
    DYLKEVFEKLRDLYEKFTPAVSTYTGIFTDQVLSVLKGEE
  • Sequence
    Asp-Tyr-Leu-Lys-Glu-Val-Phe-Glu-Lys-Leu-Arg-Asp-Leu-Tyr-Glu-Lys-Phe-Thr-Pro-Ala-Val-Ser-Thr-Tyr-Thr-Gly-Ile-Phe-Thr-Asp-Gln-Val-Leu-Ser-Val-Leu-Lys-Gly-Glu-Glu
  • Length (aa)
    40
  • Peptide Purity (HPLC)
    96%
  • Molecular Formula
    C216H332N48O67
  • Molecular Weight
    4673.3
  • Source
    Synthetic
  • Form
    Powder
  • Description

    D6PV is a synthetic peptide designed as an apolipoprotein C-II (apoC-II) mimetic. Its structure is derived from the native human apoC-II sequence, specifically incorporating a modified central region (residues 40-57) linked to the C-terminal helix (residues 58-79), which is responsible for lipoprotein lipase (LPL) activation. The design was informed by all-atom molecular dynamics simulations, which revealed the structural dynamics of apoC-II on lipid surfaces. Key amino acid substitutions in the central region enhance its helicity and lipid-binding properties, while a proline residue at position 19 introduces a hinge between the two helical domains.

    This peptide exhibits dual functionality: it directly activates LPL, the primary enzyme hydrolyzing triglycerides in plasma, and it acts as an apolipoprotein C-III (apoC-III) antagonist. D6PV displaces apoC-III from very low-density lipoproteins (VLDL) and high-density lipoproteins (HDL), thereby counteracting the inhibitory effect of apoC-III on lipolysis. Biophysical characterization demonstrates that D6PV is highly helical and effectively binds to and solubilizes lipid vesicles. It primarily associates with HDL, which serves as a reservoir, contributing to an extended plasma half-life.

  • Storage Guidelines
    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • References
    • Wolska A, Lo L, Sviridov DO, Pourmousa M, Pryor M, Ghosh SS, Kakkar R, Davidson M, Wilson S, Pastor RW, Goldberg IJ, Basu D, Drake SK, Cougnoux A, Wu MJ, Neher SB, Freeman LA, Tang J, Amar M, Devalaraja M, Remaley AT. A dual apolipoprotein C-II mimetic-apolipoprotein C-III antagonist peptide lowers plasma triglycerides. Sci Transl Med. 2020 Jan 29;12(528):eaaw7905. doi: 10.1126/scitranslmed.aaw7905. PMID: 31996466; PMCID: PMC8359806.
    • Benitez Amaro A, Solanelles Curco A, Garcia E, Julve J, Rives J, Benitez S, Llorente Cortes V. Apolipoprotein and LRP1-Based Peptides as New Therapeutic Tools in Atherosclerosis. J Clin Med. 2021 Aug 13;10(16):3571. doi: 10.3390/jcm10163571. PMID: 34441867; PMCID: PMC8396846.
  • About TFA salt

    Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

    Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

    Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

    In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"