Amylin peptide

Amylin peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-KCNTATCVTQRLADFLVRSSNTRGTVYAPTNVGANTY-OH

H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Val-Arg-Ser-Ser-Asn-Thr-Arg-Gly-Thr-Val-Tyr-Ala-Pro-Thr-Asn-Val-Gly-Ala-Asn-Thr-Tyr-OH

37

95.5%

C₁₆₉H₂₇₄N₅₂O₅₆S₂

3994.41

Synthetic

Powder

The source of Amylin is foldfish takifugu (Carassius auratus). Goldfish Amylin is a conserved peptide showing the typical structure characteristics present in their mammalian counterparts.
Amylin mRNA is mostly expressed in the brain, in particular posterior brain, optic tectum and hypothalamus, but is also present in pituitary, gonad, kidney and muscle. Amylin mRNA distribution suggests possible new roles for this peptide in teleosts, including the control of reproduction.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Martínez-alvarez RM, Volkoff H, Cueto JA, Delgado MJ. Molecular characterization of calcitonin gene-related peptide (CGRP) related peptides (CGRP, amylin, adrenomedullin and adrenomedullin-2/intermedin) in goldfish (Carassius auratus): cloning and distribution. Peptides. 2008;29(9):1534-43.

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.