Abaecin peptide

Abaecin peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY

H-Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr-OH

34

97.6%

C₁₈₇H₂₇₀N₄₈O₄₃

3878.4

Synthetic

Powder

Rich in P. Active against A. tumefaciens Gembloux A, E. salicis NCPPB 2530, E. coli NCTC 9001 (MIC 25-50 ug/ml), E. coli NCTC 9001*, E. coli K514 (MIC 10-25 ug/ml), P. syringae pv. tomamta NCPPB 1105 (MIC 25-50 ug.ml), X. campestris pv. vesicatoria LMG 905 (MIC 5-10 ug/ml), and Gram-positive bacteria B. megaterium OMB 1551 (MIC 10-25 ug/ml) and M. luteus (M. lysodeikticus) LMG 4050 (MIC 10-25 ug/ml). Thus, the highest observed specific activity of the peptide was against an apidaecin-resistant Xanthomonas strain. Relish regulates expression of antimicrobial peptide genes in the honeybee, Apis mellifera, shown by RNA interference (Insect Mol Biol. 2007 Dec;16(6):753-9). APD Updated 10/2008. name corrected 5/2014 GW. Abaecin has Antibacterial activity. Abaecin was found in honeybee, Apis mellifera L..

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

• Casteels P, Ampe C, Riviere L, et al. Isolation and characterization of abaecin, a major antibacterial response peptide in the honeybee (Apis mellifera). Eur J Biochem. 1990;187(2):381-6.

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.