TLQP-62 peptide (TFA removed)

TLQP-62 peptide (TFA removed)

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

1 Vial

TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP

Thr-Leu-Gln-Pro-Pro-Ala-Ser-Ser-Arg-Arg-Arg-His-Phe-His-His-Ala-Leu-Pro-Pro-Ala-Arg-His-His-Pro-Asp-Leu-Glu-Ala-Gln-Ala-Arg-Arg-Ala-Gln-Glu-Glu-Ala-Asp-Ala-Glu-Glu-Arg-Arg-Leu-Gln-Glu-Gln-Glu-Glu-Leu-Glu-Asn-Tyr-Ile-Glu-His-Val-Leu-Leu-His-Arg-Pro

62

94.9%

C₃₁₈H₄₉₉N₁₀₉O₉₇

7401.01

Synthetic

The source of TLQP-62 is Rattus norvegicus. TLQP-62 belongs to VGF. TLQP-62 is expressed in Central and peripheral nervous systems, synthesized exclusively in neuronal and neuroendocrine cells.
The C-terminal peptide TLQP-62 is of particular relevance to maladaptive mechanisms of chronic pain as it is a known mediator of neuroplasticity in the hippocampus affecting learning, memory, depression, and adult neurogenesis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

• Moss A, Ingram R, Koch S, Theodorou A, Low L, Baccei M, et al. Origins, actions and dynamic expression patterns of the neuropeptide VGF in rat peripheral and central sensory neurones following peripheral nerve injury. Mol Pain. 2008
• Skorput AGJ, Zhang X, Waataja JJ, Peterson CD, Riedl MS, Kitto KF, Truong H, Huffman C, Salton SR, Fairbanks CA, Honda CN, Vulchanova L. Involvement of the VGF-derived peptide TLQP-62 in nerve injury-induced hypersensitivity and spinal neuroplasticity. Pain. 2018 Sep;159(9):1802-1813. doi: 10.1097/j.pain.0000000000001277.

Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

TFA Removal Service is recommended for:

• Peptides that will be used in cellular assays
• Peptides that will be used as APIs or in manufactured products
• For hydrophilic peptides containing numerous basic residues