TIP 39 peptide

TIP 39 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-OH

H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH

39

95.92%

C₂₀₂H₃₂₅N₆₁O₅₄S

4504.16

Synthetic

Powder

TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Usdin et al (1999) TIP39: a new neuropeptide and PTH2-receptor agonist from hypothalamus. Nat. Neurosci 2 941 PMID: 10526330
• Della Penna et al (2003) Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor, Neuropharmacology 44(1) 141 https://doi.org/10.1016/S0028-3908(02)00335-0
• Weaver et al (2017) High affinity binding of the peptide agonist TIP-39 to the parathyroid hormone 2 (PTH2) receptor requires the hydroxyl group of Tyr-318 on transmembrane helix 5, Biochemical Pharmacology 127 71 PMID: 28012961

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.