Sushi peptide 3 (171-204 aa)

Sushi peptide 3 (171-204 aa)

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

HAEHKVKIGVEQKYGQFPQGTEVTYTCSGNYFLM

His-Ala-Glu-His-Lys-Val-Lys-Ile-Gly-Val-Glu-Gln-Lys-Tyr-Gly-Gln-Phe-Pro-Gln-Gly-Thr-Glu-Val-Thr-Tyr-Thr-Cys-Ser-Gly-Asn-Tyr-Phe-Leu-Met

34

95.6%

Synthetic

Powder

A peptide derived from the LPS-binding sushi domain of factor C. The source of Sushi peptide 3 is Protein-derived peptide. Synthetic peptides derived from two regions of factor C (Sushi 1 and Sushi 3) have potent antimicrobial activities against 30 clinical Pseudomonas aeruginosa isolates. These peptides have low hemolytic activity and are tolerant of high salt and adverse pH conditions, suggesting potential therapeutic applications.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Yau YH, Ho B, Tan NS, Ng ML, Ding JL. High therapeutic index of factor C Sushi peptides: potent antimicrobials against Pseudomonas aeruginosa. Antimicrob Agents Chemother. 2001 Oct;45(10):2820-5. doi: 10.1128/AAC.45.10.2820-2825.2001. PMID: 11557475; PMCID: PMC90737.
• Lee LF, Mariappan V, Vellasamy KM, Lee VS, Vadivelu J. Antimicrobial activity of Tachyplesin 1 against Burkholderia pseudomallei: an in vitro and in silico approach. PeerJ. 2016 Oct 25;4:e2468. doi: 10.7717/peerj.2468. PMID: 27812400; PMCID: PMC5088614.

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.