NovoPro
Cart 2
  • Papiliocin

Papiliocin

Cat.#: 318870

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 299.74 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Papiliocin
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    H-RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2
  • Three letter code
    H-Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Val-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Ala-Thr-Val-Val-Lys-Amidation
  • Length (aa)
    37
  • Peptide Purity (HPLC)
    95.2
  • Molecular Formula
    C183H314N56O44
  • Molecular Weight
    4002.78
  • Source
    Synthetic
  • Additional Information
    Papiliocin is a novel 37-residue cecropin-like peptide isolated recently from the swallowtail butterfly, Papilio xuthus. With the aim of identifying a potent antimicrobial peptide, Dr. Kim tested papiliocin in a variety of biological and biophysical assays, demonstrating that the peptide possesses very low cytotoxicity against mammalian cells and high bacterial cell selectivity, particularly against Gram-negative bacteria as well as high anti-inflammatory activity. Using LPS-stimulated macrophage RAW264.7 cells, we found that papiliocin exerted its anti-inflammatory activities by inhibiting nitric oxide (NO) production and secretion of tumor necrosis factor (TNF)-α and macrophage inflammatory protein (MIP)-2, producing effects comparable with those of the antimicrobial peptide LL-37.
  • Storage Guidelines
    Ideally Papiliocin should be stored in a freezer at or below -9C. Papiliocin should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • Kim JK, Lee E, Shin S, et al. Structure and function of papiliocin with antimicrobial and anti-inflammatory activities isolated from the swallowtail butterfly, Papilio xuthus. J Biol Chem. 2011;286(48):41296-41311. doi:10.1074/jbc.M111.269225
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Property

  • Analysed Sequence:H-RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-Amidation
  • Chemical Formula:C183H314N56O44
  • Sequence length:37
  • Extinction coefficient:5690 M-1cm-1
  • GRAVY:0.09
  • Mw average:4002.78
  • Theoretical pI:11.62
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"