Papiliocin peptide

Papiliocin peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK

Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Val-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Ala-Thr-Val-Val-Lys

37

96.7%

Synthetic

Powder

Injection of bacterial LPS induces the production of this peptide. Although papiliocin displayed a broad antimicrobial spectrum, it is not hemolytic and especially active against Gram-negative bacteria. This cecropin-like membrane-active peptide may form a pore (2.3-3.3 nm) in the fungal membranes (J Microbiol Biotechnol. 2010 Aug;20(8):1185-8). It could also induce yeast apoptosis (Hwang B et al 2011 Biochem Biophys Res Commun. 408: 89-93). The peptide also showed antiinfammatory activities. In DPC micelles, the peptide adopted a helix-hinge-helix conformation (H1:residues 3-21 and H2: 25-36). Residues W2 and F5 are proposed to be important for LPS binding (Kim JK et al. 2011 J Biol Chem 286:41296-311). Updated 10/24/11; 12/23/11 GW. Papiliocin has Antibacterial, Antifungal activity. The source of Papiliocin is the swallowtail butterfly, Papilio xuthus.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.