• LCI peptide

LCI peptide

Not For Human Use, Lab Use Only.

Cat.#: 319281

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 564.0 USD

Availability: 5 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    LCI peptide
  • Documents
  • Sequence
    H-AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK-NH2
  • Three letter code
    H-Ala-Ile-Lys-Leu-Val-Gln-Ser-Pro-Asn-Gly-Asn-Phe-Ala-Ala-Ser-Phe-Val-Leu-Asp-Gly-Thr-Lys-Trp-Ile-Phe-Lys-Ser-Lys-Tyr-Tyr-Asp-Ser-Ser-Lys-Gly-Tyr-Trp-Val-Gly-Ile-Tyr-Glu-Val-Trp-Asp-Arg-Lys-NH2
  • Length (aa)
    47
  • Peptide Purity (HPLC)
    95.16%
  • Molecular Formula
    C259H379N63O68
  • Molecular Weight
    5463.13
  • Source
    Synthetic
  • Additional Information
    Peptide LCI is an adhesion-promoting peptide used in the Matter-tag-based enzyme immobilization platform. It contains several basic and acidic amino acids such as Asp and Arg, which are polar in nature and may be involved in interaction with various materials including polymers, metals, and silicon-based materials. LCI was identified as a universal adhesion promoter and was able to immobilize both enzymes (phytase and cellulase) on all investigated materials. Studies suggest that the adsorption behavior of a peptide can be largely electrostatic, and the polar residues in LCI may contribute to the adsorption energy on stainless steel and gold surfaces.
  • Storage Guidelines
    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • Dedisch S, Wiens A, Davari MD, Söder D, Rodriguez-Emmenegger C, Jakob F, Schwaneberg U. Matter-tag: A universal immobilization platform for enzymes on polymers, metals, and silicon-based materials. Biotechnol Bioeng. 2020 Jan;117(1):49-61. doi: 10.1002/bit.27181. Epub 2019 Oct 9. PMID: 31549734.
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"