LCI peptide

LCI peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK-NH2

H-Ala-Ile-Lys-Leu-Val-Gln-Ser-Pro-Asn-Gly-Asn-Phe-Ala-Ala-Ser-Phe-Val-Leu-Asp-Gly-Thr-Lys-Trp-Ile-Phe-Lys-Ser-Lys-Tyr-Tyr-Asp-Ser-Ser-Lys-Gly-Tyr-Trp-Val-Gly-Ile-Tyr-Glu-Val-Trp-Asp-Arg-Lys-NH2

47

95.16%

C₂₅₉H₃₇₉N₆₃O₆₈

5463.13

Synthetic

Powder

Peptide LCI is an adhesion-promoting peptide used in the Matter-tag-based enzyme immobilization platform. It contains several basic and acidic amino acids such as Asp and Arg, which are polar in nature and may be involved in interaction with various materials including polymers, metals, and silicon-based materials. LCI was identified as a universal adhesion promoter and was able to immobilize both enzymes (phytase and cellulase) on all investigated materials. Studies suggest that the adsorption behavior of a peptide can be largely electrostatic, and the polar residues in LCI may contribute to the adsorption energy on stainless steel and gold surfaces.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Dedisch S, Wiens A, Davari MD, Söder D, Rodriguez-Emmenegger C, Jakob F, Schwaneberg U. Matter-tag: A universal immobilization platform for enzymes on polymers, metals, and silicon-based materials. Biotechnol Bioeng. 2020 Jan;117(1):49-61. doi: 10.1002/bit.27181. Epub 2019 Oct 9. PMID: 31549734.

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.