Kisspeptin-54 (human) peptide

Kisspeptin-54 (human) peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

54

98.77%

C₂₅₈H₄₀₁N₇₉O₇₈

5857.41

374683-24-6

Synthetic

Powder

Kisspeptin-54 (human), also known as metastin, is a 54-amino-acid peptide encoded by the KiSS-1 gene. It was first isolated from human placenta and identified as the endogenous ligand of the G protein-coupled receptor GPR54 (KISS1R). Kisspeptin–GPR54 signaling is essential for pubertal development and reproductive function: mice lacking GPR54 and humans carrying GPR54-null mutations fail to mature sexually and exhibit low circulating gonadotropins and sex hormones (hypogonadotropic hypogonadism). Peripheral administration of kisspeptin-54 potently stimulates gonadotropin release and induces ovulation in rats, and it also stimulates LH release in humans, confirming its role as a key regulator of the hypothalamic-pituitary-gonadal (HPG) axis. Kisspeptin-54 is therefore a valuable tool for studying reproductive neuroendocrinology and the regulation of gonadotropin secretion.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• [1] M Kotani, et al. The Metastasis Suppressor Gene KiSS-1 Encodes Kisspeptins, the Natural Ligands of the Orphan G Protein-Coupled Receptor GPR54. J Biol Chem. 2001 Sep 14;276(37):34631-6. https://doi.org/10.1074/jbc.m104847200
• [2] Dhillo WS, et al. Kisspeptin-54 stimulates the hypothalamic-pituitary gonadal axis in human males. J Clin Endocrinol Metab. 2005 Dec;90(12):6609-15. Epub 2005 Sep 20. https://doi.org/10.1210/jc.2005-1468
• [3] Abbara A, et al. Efficacy of Kisspeptin-54 to Trigger Oocyte Maturation in Women at High Risk of Ovarian Hyperstimulation Syndrome (OHSS) During In Vitro Fertilization (IVF) Therapy. J Clin Endocrinol Metab. 2015 Sep;100(9):3322-31. https://doi.org/10.1210/jc.2015-2332

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.