INF7TAT-A5K peptide

INF7TAT-A5K peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

1 Vial

H-GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR-OH

H-Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-OH

33

95.5%

C₁₈₂H₂₇₅N₅₅O₄₈S

4033.52

Synthetic

Peptide A5K (GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR; 4033.6 Da) is derived from the scaffold INF7-TAT. A5K peptide could be used to mediate delivery of CRISPR enzymes for the efficient editing of primary human lymphocytes.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

• Foss DV, Muldoon JJ, Nguyen DN, Carr D, Sahu SU, Hunsinger JM, Wyman SK, Krishnappa N, Mendonsa R, Schanzer EV, Shy BR, Vykunta VS, Allain V, Li Z, Marson A, Eyquem J, Wilson RC. Peptide-mediated delivery of CRISPR enzymes for the efficient editing of primary human lymphocytes. Nat Biomed Eng. 2023 May;7(5):647-660. doi: 10.1038/s41551-023-01032-2. Epub 2023 Apr 25. PMID: 37147433; PMCID: PMC10129304.

Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

TFA Removal Service is recommended for:

• Peptides that will be used in cellular assays
• Peptides that will be used as APIs or in manufactured products
• For hydrophilic peptides containing numerous basic residues