NovoPro
Cart 2
  • HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide

HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide

For research use only. We do not sell to patients.

Cat.#: 307298

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 468 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • Three letter code
    Gly-Phe-Phe-Lys-Lys-Ala-Trp-Arg-Lys-Val-Lys-His-Ala-Gly-Arg-Arg-Val-Leu-Asp-Thr-Ala-Lys-Gly-Val-Gly-Arg-His-Tyr-Val-Asn-Asn-Trp-Leu-Asn-Arg-Tyr-Arg
  • Length (aa)
    37
  • Peptide Purity (HPLC)
    97.0
  • Source
    Synthetic
  • Additional Information
    W7 and W32 are brominated. Active against Gram+ bacteria P. acnes ATCC 11827 and 33179, S. epidermidi, S. pyogenes, E. faecium, S. aureus ATCC 29213, C. perfringens ATCC 9081 and 13124, E. faecalis (MIC 2-32 uM); Gram- bacteria Bacteroides spp. ATCC 29771, 43935, and 12290, S. sonnei, S. maltophilia, Salmonella Group B, P. aeruginosa ATCC 27853, A. baumannii, E. coli ATCC 25922, E. aerogenes, E. cloacae, K. pneumoniae (MIC 0.5-16). HFIAP-2 is identical to HFIAP-1 in terms of amino acid sequence. However, HFIAP-2 is only brominated at residue W7. Updated 10/2014. HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) was found in Atlantic hagfish, Myxine glutinosa.
  • Storage Guidelines
    Ideally HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide should be stored in a freezer at or below -9C. HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"