eCATH-3 peptide

eCATH-3 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS

Lys-Arg-Phe-His-Ser-Val-Gly-Ser-Leu-Ile-Gln-Arg-His-Gln-Gln-Met-Ile-Arg-Asp-Lys-Ser-Glu-Ala-Thr-Arg-His-Gly-Ile-Arg-Ile-Ile-Thr-Arg-Pro-Lys-Leu-Leu-Leu-Ala-Ser

40

97.4%

Synthetic

Powder

present abundantly in uncleaved forms in horse neutrophils. Active against fungi various C. neoformans, R. rubra (MIC 9-37.5 ug/ml) in Sabouraud medium. The antibacterial and antifungal activity of eCATH3 appeared to be salt-senstitive since it had MICs of 2 to 20 mg/ml for bacterial cells in low-ionic-strength medium and is ineffective when tested up to 114 mg/ml in physiological salt medium. If the major function of eCATH3 is not antimicrobial, this peptide could possesses other non-antimicrobial functions (Skerlavaj B et al., 2001). Updated 7/8/2013. eCATH-3 has Antimicrobial activity. The source of eCATH-3 is myeloid cells, Horse Equus asinus.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Scocchi M, Bontempo D, Boscolo S, Tomasinsig L, Giulotto E, Zanetti M. Novel cathelicidins in horse leukocytes(1). FEBS Lett. 1999;457(3):459-64.

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.