CecropinXJ peptide

CecropinXJ peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK

Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asp-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Glu-Val-Leu-Gly-Ser-Ala-Lys-Ala-Ile-Gly-Lys

37

97.4%

Synthetic

Powder

94.59% similar to AP183 cecropin B from the same species. Active against Gram-negative bacteria E. coli ATCC 25922, K. pneumoniae, S. flexneri, A. baumannii, S. sonnei, K. ozaenae (MIC 1.4-7 uM), and Gram-positive bacteria S. aureus, D. ribution, S. epidermidis (MIC 1.8-5.7uM). It also displayed anticancer activity (Xia L et al., 2014). CecropinXJ was found in larvae, Bombyx mori.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Xia L, Liu Z, Ma J, Sun S, Yang J, Zhang F. Expression, purification and characterization of cecropin antibacterial peptide from Bombyx mori in Saccharomyces cerevisiae. Protein Expr Purif. 2013;90(1):47-54.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.