Cart 2
  • Cagrilintide, 99.20% purity peptide

Cagrilintide, 99.20% purity peptide

Not For Human Use, Lab Use Only.

Cat.#: 319572

Size:

* Buy 1 get 1 free (?)

Special Price 237.60 USD

Availability: In Stock
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Cagrilintide, 99.20% purity peptide
  • Documents

    Batch to batch variation of the purity

  • Sequence Shortening
    {Eicosanedioic-acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:C3-C8)
  • Sequence
    {Eicosanedioic-acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
  • Length (aa)
    39
  • Peptide Purity (HPLC)
    99.2%
  • Molecular Formula
    C194H312N54O59S2
  • Molecular Weight
    4409.01
  • CAS No.
    1415456-99-3
  • PubChem CID
    167312356
  • Source
    Synthetic
  • Form
    Powder
  • Description
    Cagrilintide is a long-acting amylin analogue designed for once-weekly subcutaneous delivery. Amylin is a pancreatic peptide co-secreted with insulin; the analogue is engineered for extended receptor exposure, allowing sustained target engagement.

    Mechanism: cagrilintide binds and activates the calcitonin receptor and all three amylin receptor subtypes. Evidence indicates that its effects on body weight are mediated through direct actions on brain regions governing homeostatic and hedonic appetite regulation, resulting in reduced food intake.

    Function: it serves as a chemical probe for dissecting amylin and calcitonin receptor signalling in energy balance, feeding behaviour and gastric motility, and as a reference compound for receptor pharmacology, structure-activity studies, and combination research with GLP-1 receptor agonists, whose complementary pathways act on distinct but overlapping central feeding circuits.

  • Storage Guidelines
    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • References
    • Davies MJ, Bajaj HS, Broholm C, et al. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. N Engl J Med. 2025;393(7):648-659. doi:10.1056/NEJMoa2502082
    • Frias JP, Deenadayalan S, Erichsen L, Knop FK, Lingvay I, Macura S, Mathieu C, Pedersen SD, Davies M. Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet. 2023 Aug 26;402(10403):720-730. doi: 10.1016/S0140-6736(23)01163-7. Epub 2023 Jun 23. PMID: 37364590.
    • Eržen S, Tonin G, Jurišić Eržen D, Klen J. Amylin, Another Important Neuroendocrine Hormone for the Treatment of Diabesity. Int J Mol Sci. 2024 Jan 26;25(3):1517. doi: 10.3390/ijms25031517. PMID: 38338796; PMCID: PMC10855385.
    • Kruse T, Hansen JL, Dahl K, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021;64(15):11183-11194. doi:10.1021/acs.jmedchem.1c00565
    • Dehestani B, Stratford NR, le Roux CW. Amylin as a Future Obesity Treatment. J Obes Metab Syndr. 2021;30(4):320-325. doi:10.7570/jomes21071
    • Fletcher MM, Keov P, Truong TT, et al. AM833 Is a Novel Agonist of Calcitonin Family G Protein-Coupled Receptors: Pharmacological Comparison with Six Selective and Nonselective Agonists. J Pharmacol Exp Ther. 2021;377(3):417-440. doi:10.1124/jpet.121.000567
  • About TFA salt

    Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

    Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

    Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

    In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight

• Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

• Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

• Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"