BNP-32 (human), Brain natriuretic peptide-32

BNP-32 (human), Brain natriuretic peptide-32

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH

32

98%

C₁₄₃H₂₄₄N₅₀O₄₂S₄

3464.09

Synthetic

Powder

The secretion of the cardiac hormone BNP-32 is increased considerably in patients with congestive heart failure, successful medical treatment of this condition will result in a decrease. Hence it may serve as a humoral marker. Yandle et al. described a method for determining hBNP in human plasma. Effects of hBNP infusion in man have been described by Holmes et al and La Villa et al. Additionally, BNP-32 may act as a neuropeptide.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• M.Mukoyama et al., J. Clin. Invest., 87, 1402 (1991)
• T.G.Yandle et al., J. Clin. Endocrinol. Metab., 76, 832 (1993)
• S.J.Holmes et al., J. Clin. Endocrinol. Metab., 76, 91 (1993)
• G.La Villa et al., J. Clin. Endocrinol. Metab., 78, 1166 (1994)
• H.Yoshida et al., Regul. Peptides, 61, 45 (1996)

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.