Bacteriocin SRCAM 602 peptide

Bacteriocin SRCAM 602 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-ATYYGNGLYCNKQKHYTWVDWNKASREIGKITVNGWVQH-OH

H-Ala-Thr-Tyr-Tyr-Gly-Asn-Gly-Leu-Tyr-Cys-Asn-Lys-Gln-Lys-His-Tyr-Thr-Trp-Val-Asp-Trp-Asn-Lys-Ala-Ser-Arg-Glu-Ile-Gly-Lys-Ile-Thr-Val-Asn-Gly-Trp-Val-Gln-His-OH

39

95.23%

C₂₁₁H₃₀₇N₅₉O₅₈S

4630.1

Synthetic

Powder

Bacteriocin SRCAM 602 is a bacteriocin produced by Paenibacillus polymyxa [Bacillus polymyxa], known for its broad antimicrobial spectrum against both Gram-positive and Gram-negative bacteria.
Bacteriocin SRCAM 602 is active against various bacteria, including Campylobacter spp., which is significant for reducing Campylobacter colonization in poultry and potentially controlling this foodborne pathogen.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Svetoch EA, Stern NJ, Eruslanov BV, et al. Isolation of Bacillus circulans and Paenibacillus polymyxa strains inhibitory to Campylobacter jejuni and characterization of associated bacteriocins. J Food Prot. 2005;68(1):11-7.
• Lohans CT, Huang Z, van Belkum MJ, Giroud M, Sit CS, Steels EM, Zheng J, Whittal RM, McMullen LM, Vederas JC. Structural characterization of the highly cyclized lantibiotic paenicidin A via a partial desulfurization/reduction strategy. J Am Chem Soc. 2012 Dec 5;134(48):19540-3.
• Arbulu S, Jiménez JJ, Gútiez L, Cintas LM, Herranz C, Hernández PE. Cloning and expression of synthetic genes encoding the broad antimicrobial spectrum bacteriocins SRCAM 602, OR-7, E-760, and L-1077, by recombinant Pichia pastoris. Biomed Res Int. 2015;2015:767183.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.