ACTH (1-39) (human) peptide

ACTH (1-39) (human) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH

39

95.74%

C₂₀₇H₃₀₈N₅₆O₅₈S

4541.04

Synthetic

Powder

ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior pituitary gland upon stimulation by corticotropin releasing hormone from the hypothalamus, often in response to stress. ACTH (1-39) (human) is used to treat multiple sclerosis relapses, acting by stimulating adrenal corticosteroid production through the MC2R.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

• Kapas et al (1996) Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology 137 3291 PMID: 8754753
• Ghaddhab et al (2017) From Bioinactive ACTH to ACTH Antagonist: The Clinical Perspective. Front Endocrinol (Lausanne) 8 17 PMID: 28228747
• Benjamins et al (2018) Melanocortin receptor subtypes are expressed on cells in the oligodendroglial lineage and signal ACTH protection. J Neurosci Res. 96(3) 427 PMID: 28877366

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.