A1P peptide

A1P peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP

Pro-Pro-Pro-Val-Ile-Lys-Phe-Asn-Arg-Pro-Phe-Leu-Met-Trp-Ile-Val-Glu-Arg-Asp-Thr-Arg-Ser-Ile-Leu-Phe-Met-Gly-Lys-Ile-Val-Asn-Pro-Lys-Ala-Pro

35

96.9%

Synthetic

Powder

The peptide was captured from alligator plasma by a custom-built functionalized hydrogel microparticles followed by de nono sequencing by mass spectrometer. It is 33.3% SIMILAR TO hGAPDH(2-32) . Active against E. coli, P. aeruginosa (EC50 0.098 and 4.35 uM), B. cereus, and S. aureus (EC50 0.77 and 1.36 uM). A1P was found in plasma, the American Alligator, Alligator mississippiensis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Bishop BM, Juba ML, Devine MC, et al. Bioprospecting the American alligator (Alligator mississippiensis) host defense peptidome. PLoS ONE. 2015;10(2):e0117394.

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.