3×HA peptide

3×HA peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE

Met‑Glu‑Tyr‑Pro‑Tyr‑Asp‑Val‑Pro‑Asp‑Tyr‑Ala‑Ala‑Glu‑Tyr‑Pro‑Tyr‑Asp‑Val‑Pro‑Asp‑Tyr‑Ala‑Ala‑Glu‑Tyr‑Pro‑Tyr‑Asp‑Val‑Pro‑Asp‑Tyr‑Ala‑Ala‑Lys‑Leu‑Glu

37

96.4%

C₂₀₅H₂₇₂N₃₈O₆₇S

4372.7

Synthetic

Powder

3×HA Peptide is a synthetic peptide presenting three tandem copies of the influenza hemagglutinin (HA) epitope (YPYDVPDYA), intended as a competitive eluent for anti-HA affinity matrices. It corresponds to three tandem copies of the hemagglutinin (HA) epitope derived from the human influenza virus HA protein. The triple arrangement of the epitope is designed to enhance affinity toward anti-HA antibodies compared to a single HA tag.

The 3×HA peptide is used as a competitive eluent in co-immunoprecipitation procedures. When 3×HA-tagged bait proteins are captured by anti-HA antibodies immobilized on magnetic beads or agarose resin, the addition of excess 3×HA peptide displaces the tagged bait from the antibody through competitive binding. This allows elution of 3×HA-tagged proteins and their associated complexes in native form, preserving protein structure and biological activity, while matrix-bound unspecific proteins and antibodies remain on the support. Optimal elution conditions, including peptide concentration, temperature, and incubation time, are typically determined empirically to maximize yield and purity.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Lim J, Lilie H, Kalbacher H, Roos N, Frecot DI, Feige M, Conrady M, Votteler T, Cousido-Siah A, Corradini Bartoli G, Iftner T, Trave G, Simon C. Evidence for direct interaction between the oncogenic proteins E6 and E7 of high-risk human papillomavirus (HPV). J Biol Chem. 2023 Aug;299(8):104954. doi: 10.1016/j.jbc.2023.104954. Epub 2023 Jun 23. PMID: 37354975; PMCID: PMC10372912.
• Lim J, Lilie H, Kalbacher H, Roos N, Frecot DI, Feige M, Conrady M, Votteler T, Cousido-Siah A, Corradini Bartoli G, Iftner T, Trave G, Simon C. Evidence for direct interaction between the oncogenic proteins E6 and E7 of high-risk human papillomavirus (HPV). J Biol Chem. 2023 Aug;299(8):104954. doi: 10.1016/j.jbc.2023.104954. Epub 2023 Jun 23. PMID: 37354975; PMCID: PMC10372912.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.