pG-Sable vector (V006139)

Download GeneBank File(.gb)

LOCUS       40924_20811        4785 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pG-Sable, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4785)
  AUTHORS   Foureau E, Courdavault V, Simkin AJ, Sibirny AA, Creche J, 
            Giglioli-Guivarc'h N, Clastre M, Papon N.
  TITLE     Transformation of Candida guilliermondii wild-type strains using the
            Staphylococcus aureus MRSA 252 ble gene as a phleomycin-resistant 
            marker
  JOURNAL   FEMS Yeast Res. 13 (3), 354-358 (2013)
  PUBMED    23374647
REFERENCE   2  (bases 1 to 4785)
  AUTHORS   Papon N.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2013) Ea2106 Biomolecules et Biotechnologie 
            Vegetales, Universite Francois Rabelais de Tours, 31 Avenue Monge, 
            Tours, Centre F-37200, France
REFERENCE   3  (bases 1 to 4785)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4785)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "FEMS Yeast 
            Res."; date: "2013"; volume: "13"; issue: "3"; pages: "354-358"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-JAN-2013) Ea2106 Biomolecules et Biotechnologie Vegetales, 
            Universite Francois Rabelais de Tours, 31 Avenue Monge, Tours, 
            Centre F-37200, France"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4785
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      31..656
                     /note="derived from C. guilliermondii phosphoglycerate
                     kinase (PGK) 5'UTR"
                     /regulatory_class="promoter"
     CDS             675..1073
                     /codon_start=1
                     /product="glyoxalase"
                     /EC_number="4.4.1.5"
                     /label=glyoxalase
                     /note="confers resistance to phleomycin and zeocin; derived
                     from Staphylococcus aureus MRSA 252 ble"
                     /protein_id="AGI99512.1"
                     /translation="MLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEVRI
                     HLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNTSL
                     KDQWWDERDFAVIDPDNNLISFFQQIKS"
     regulatory      1089..1746
                     /note="derived from C. guilliermondii phosphoglycerate
                     kinase gene (PGK) 3'UTR"
                     /regulatory_class="terminator"
     promoter        complement(1850..1868)
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     primer_bind     complement(1886..1902)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(1910..1926)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1934..1964)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(1979..2000)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(2288..2876)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3050..3907)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3908..4012)
                     /label=AmpR promoter
     rep_origin      complement(4090..4545)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     4686..4702
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        4709..4727
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      4758..4767
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     regulatory      4762..4771
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"