Basic Vector Information
- Vector Name:
- pCPT8
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3012 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Pitulle C, Pace NR.
- Promoter:
- SP6
pCPT8 vector Map
pCPT8 vector Sequence
LOCUS 40924_13175 3012 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pCPT8, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3012)
AUTHORS Pitulle C, Pace NR.
TITLE Novel T-cloning vector for plasmid-based 16S rDNA analysis
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3012)
AUTHORS Pitulle C.
TITLE Direct Submission
JOURNAL
REFERENCE 3 (bases 1 to 3012)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3012)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(16-SEP-1998) Plant "
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3012
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..136
/label=multiple cloning site
/note="multiple cloning site"
misc_feature 1
/label=T7 RNA polymerase initiation site
/note="T7 RNA polymerase initiation site"
misc_feature 15..29
/label=XcmI restriction site
/note="XcmI restriction site"
misc_feature 32..46
/label=XcmI restriction site
/note="XcmI restriction site"
promoter complement(134..152)
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
primer_bind complement(170..186)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(194..210)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(218..248)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(263..284)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(572..1160)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1334..2191)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCHTLLSRIDAGQEQLGRRARYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(2192..2296)
/label=AmpR promoter
rep_origin complement(2377..2832)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 2973..2989
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 2996..3012
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.