Basic Vector Information
- Vector Name:
- pCPT8
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3012 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Pitulle C, Pace NR.
- Promoter:
- SP6
pCPT8 vector Vector Map
pCPT8 vector Sequence
LOCUS 40924_13175 3012 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCPT8, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3012) AUTHORS Pitulle C, Pace NR. TITLE Novel T-cloning vector for plasmid-based 16S rDNA analysis JOURNAL Unpublished REFERENCE 2 (bases 1 to 3012) AUTHORS Pitulle C. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 3012) TITLE Direct Submission REFERENCE 4 (bases 1 to 3012) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-SEP-1998) Plant " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3012 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..136 /label=multiple cloning site /note="multiple cloning site" misc_feature 1 /label=T7 RNA polymerase initiation site /note="T7 RNA polymerase initiation site" misc_feature 15..29 /label=XcmI restriction site /note="XcmI restriction site" misc_feature 32..46 /label=XcmI restriction site /note="XcmI restriction site" promoter complement(134..152) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" primer_bind complement(170..186) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(194..210) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(218..248) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(263..284) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(572..1160) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1334..2191) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCHTLLSRIDAGQEQLGRRARYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(2192..2296) /label=AmpR promoter rep_origin complement(2377..2832) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 2973..2989 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2996..3012 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.