Basic Vector Information
- Vector Name:
- pCPP5264
- Antibiotic Resistance:
- Tetracycline
- Length:
- 12904 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Wei CF, Kvitko BH, Shimizu R, Crabill E, Alfano JR, Lin NC, Martin GB, Huang HC, Collmer A.
pCPP5264 vector Map
pCPP5264 vector Sequence
LOCUS 40924_13150 12904 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCPP5264, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12904) AUTHORS Wei CF, Kvitko BH, Shimizu R, Crabill E, Alfano JR, Lin NC, Martin GB, Huang HC, Collmer A. TITLE A Pseudomonas syringae pv. tomato DC3000 mutant lacking the type III effector HopQ1-1 is able to cause disease in the model plant Nicotiana benthamiana JOURNAL Plant J. 51 (1), 32-46 (2007) PUBMED 17559511 REFERENCE 2 (bases 1 to 12904) AUTHORS Kvitko BH, Ramos AR, Morello JE, Oh HS, Collmer A. TITLE Identification of harpins in Pseudomonas syringae pv. tomato DC3000, which are functionally similar to HrpK1 in promoting translocation of type III secretion system effectors JOURNAL J. Bacteriol. 189 (22), 8059-8072 (2007) PUBMED 17873033 REFERENCE 3 (bases 1 to 12904) AUTHORS Kvitko BH, Ramos AR, Morello JE, Oh H-S., Collmer A. TITLE Direct Submission JOURNAL Submitted (09-JUL-2007) Plant Pathology, Cornell University, 334 Plant Science, Ithaca, NY 14853, USA REFERENCE 4 (bases 1 to 12904) TITLE Direct Submission REFERENCE 5 (bases 1 to 12904) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; date: "2007"; volume: "51"; issue: "1"; pages: "32-46" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "J. Bacteriol."; date: "2007"; volume: "189"; issue: "22"; pages: "8059-8072" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (09-JUL-2007) Plant Pathology, Cornell University, 334 Plant Science, Ithaca, NY 14853, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..12904 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(65..81) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(89..105) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(113..143) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(158..179) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(414..782) /label=traJ /note="oriT-recognizing protein" oriT complement(815..924) /direction=LEFT /label=oriT /note="incP origin of transfer" misc_feature 1056..1289 /note="similar to plasmid ColE1 in GenBank Accession Number NC_001371" misc_feature 1281..1433 /note="similar to plasmid ColE1 in GenBank Accession Number NC_001371" CDS complement(1608..2255) /label=TetR /note="tetracycline resistance regulatory protein" CDS 2361..3557 /label=TcR /note="tetracycline efflux protein" CDS complement(4191..4856) /codon_start=1 /product="unknown plasmid factor 16.5" /label=unknown plasmid factor 16.5 /protein_id="ABS87292.1" /translation="MTWCIANARALWGQFRLGVQQPALYWHFRNKRALLDALASLSIAR AHGALYELPINRGLKLTIVIKAQIRRLGAADVQDFREIRLSALKKAPEMFGSVYEHEEK KPMEAFAERLRDAVAFGAYIDGEIIGLSVFKQEDGPKDAHKAHLSGVFVEPEQRGRGVA GMLLRALPAGLLLVMIVRQIPTGIWWMRIFILGALNISLFWSLLFISVYRLPGGSRRR" CDS complement(4834..5979) /label=trfA /note="trans-acting replication protein that binds to and activates oriV" CDS complement(6028..6378) /codon_start=1 /gene="ssb" /product="single-stranded DNA binding protein" /label=ssb /protein_id="ABS87295.1" /translation="MSHNQFQFIGNLTRDTEVRHGNSNKPQAIFDIAVNEEWRNDAGDK QERTDFFRIKCFGSQAEAHGKYLGKGSLVFVQGKIRNTKYEKDGQTVYGTDFIADKVDY LDTKAPGGSNQE" gene complement(6028..6378) /gene="ssb" /label=ssb CDS 6499..6864 /codon_start=1 /gene="trbA" /product="TrbA" /label=trbA /protein_id="ABS87296.1" /translation="MYNQIFFTNILRLLDERGMTKHELSERAGVSISFLSDLTNGKANP SLKVMEAIADALETPLPLLLESTDLDREALAEIAGHPFKSSVPPGYERISVVLPSHKAF IVKKWGDDTRKKLRGRL" gene 6499..6864 /gene="trbA" /label=trbA CDS complement(7902..8996) /codon_start=1 /gene="incC1" /product="IncC1" /label=incC1 /protein_id="ABS87297.1" /translation="MGVIHEETAYRKPVPGGDPGAGSGAADHRDSAGRLSRWEATGDVR NVAGTDQGRSVASGASRVGRVRGQELARGVRAGNGGSAGTSGVHRPEVGSGRQEKTGNQ TMKTLVTANQKGGVGKTSTLVHLAFDFFERGLRVAVIDLDPQGNASYTLKDFATGLHAS KLFGAVPAGGWTETAPAAGDGQAARLALIESNPVLANAERLSLDDARELFGANIKALAN QGFDVCLIDTAPTLGVGLAAALFAADYVLSPIELEAYSIQGIKKMVTTIANVRQKNAKL QFLGMVPSKVDARNPRHARHQAELLAAYPKMMIPATVGLRSSIADALASGVPVWKIKKT AARKASKEVRALADYVFTKMEISQ" gene complement(7902..8996) /gene="incC1" /label=incC1 CDS complement(7902..8681) /codon_start=1 /gene="incC2" /product="IncC2" /label=incC2 /protein_id="ABS87298.1" /translation="MKTLVTANQKGGVGKTSTLVHLAFDFFERGLRVAVIDLDPQGNAS YTLKDFATGLHASKLFGAVPAGGWTETAPAAGDGQAARLALIESNPVLANAERLSLDDA RELFGANIKALANQGFDVCLIDTAPTLGVGLAAALFAADYVLSPIELEAYSIQGIKKMV TTIANVRQKNAKLQFLGMVPSKVDARNPRHARHQAELLAAYPKMMIPATVGLRSSIADA LASGVPVWKIKKTAARKASKEVRALADYVFTKMEISQ" gene complement(7902..8681) /gene="incC2" /label=incC2 CDS complement(8678..8983) /codon_start=1 /gene="korA" /product="KorA" /label=korA /protein_id="ABS87299.1" /translation="MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLG LTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQETKR" gene complement(8678..8983) /gene="korA" /label=korA rep_origin complement(9448..10159) /direction=LEFT /label=oriV /note="incP origin of replication" misc_feature complement(10154..10307) /note="similar to plasmid ColE1 in GenBank Accession Number NC_001371" misc_feature complement(10299..10529) /note="similar to plasmid ColE1 in GenBank Accession Number NC_001371" primer_bind 10669..10685 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 10715..10739 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" RBS 10751..10771 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS complement(10794..12062) /label=FLP /note="site-specific recombinase" RBS 12066..12074 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 12163..12873 /label=lambda repressor (ts) /note="temperature-sensitive variant of the phage lambda repressor"
This page is informational only.