Basic Vector Information
- Vector Name:
- pCPC82
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7419 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Chang P, Wang W, Chen J.
pCPC82 vector Map
pCPC82 vector Sequence
LOCUS 40924_13105 7419 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pCPC82, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7419) AUTHORS Chang P, Wang W, Chen J. TITLE An efficient vector system for economical and convenient epitope-tagging and promoters switching in Candida albicans JOURNAL Unpublished REFERENCE 2 (bases 1 to 7419) AUTHORS Chang P, Wang W, Chen J. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 7419) TITLE Direct Submission REFERENCE 4 (bases 1 to 7419) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-JAN-2018) Research Center of Bioenergy " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7419 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 124..394 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" CDS 795..1508 /label=yeGFP /note="yeast-enhanced green fluorescent protein" rep_origin complement(1600..2188) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2362..3219) /label=AmpR /note="beta-lactamase" promoter complement(3220..3324) /label=AmpR promoter regulatory 3395..4129 /note="promoter region of ADH1 gene of Candida albicans; CaADH1p" /regulatory_class="promoter" CDS 4130..4747 /label=TetR /note="tetracycline repressor TetR" CDS 4769..5110 /label=GAL4 activation domain /note="activation domain of the GAL4 transcriptional activator" regulatory 5128..5434 /note="terminator region of ACT1 gene of Candida albicans; ACT1 terminator" /regulatory_class="terminator" CDS 5781..7187 /codon_start=1 /product="Arg4" /label=Arg4 /protein_id="AVR52663.1" /translation="MSQQQDKQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADL TGTKVYTQGLNKLGLITTEELHLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGE IIGKNISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMP GYTHLQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREF LAKGLGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLA DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEPLF DALTTVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHISG ECVRKAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDAIGGTAKSAVLK QLENLKSILS"
This page is informational only.