Basic Vector Information
- Vector Name:
- pCPC80
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7372 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Chang P, Wang W, Chen J.
pCPC80 vector Vector Map
pCPC80 vector Sequence
LOCUS 40924_13095 7372 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pCPC80, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7372) AUTHORS Chang P, Wang W, Chen J. TITLE An efficient vector system for economical and convenient epitope-tagging and promoters switching in Candida albicans JOURNAL Unpublished REFERENCE 2 (bases 1 to 7372) AUTHORS Chang P, Wang W, Chen J. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 7372) TITLE Direct Submission REFERENCE 4 (bases 1 to 7372) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-JAN-2018) Research Center of Bioenergy " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7372 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 124..394 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" CDS 828..854 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" CDS 858..884 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" CDS 888..914 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" rep_origin complement(1553..2141) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2315..3172) /label=AmpR /note="beta-lactamase" promoter complement(3173..3277) /label=AmpR promoter regulatory 3348..4082 /note="promoter region of ADH1 gene of Candida albicans; CaADH1p" /regulatory_class="promoter" CDS 4083..4700 /label=TetR /note="tetracycline repressor TetR" CDS 4722..5063 /label=GAL4 activation domain /note="activation domain of the GAL4 transcriptional activator" regulatory 5081..5387 /note="terminator region of ACT1 gene of Candida albicans; ACT1 terminator" /regulatory_class="terminator" CDS 5734..7140 /codon_start=1 /product="Arg4" /label=Arg4 /protein_id="AVR52659.1" /translation="MSQQQDKQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADL TGTKVYTQGLNKLGLITTEELHLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGE IIGKNISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMP GYTHLQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREF LAKGLGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLA DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEPLF DALTTVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHISG ECVRKAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDAIGGTAKSAVLK QLENLKSILS"
This page is informational only.