Basic Vector Information
- Vector Name:
- pCPC29
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8200 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Chang P, Wang W, Chen J.
pCPC29 vector Map
pCPC29 vector Sequence
LOCUS 40924_12975 8200 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pCPC29, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8200) AUTHORS Chang P, Wang W, Chen J. TITLE An efficient vector system for economical and convenient epitope-tagging and promoters switching in Candida albicans JOURNAL Unpublished REFERENCE 2 (bases 1 to 8200) AUTHORS Chang P, Wang W, Chen J. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 8200) TITLE Direct Submission REFERENCE 4 (bases 1 to 8200) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-JAN-2018) Research Center of Bioenergy " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8200 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(292..880) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1054..1911) /label=AmpR /note="beta-lactamase" promoter complement(1912..2016) /label=AmpR promoter misc_feature 2118..2562 /note="5' region of EAF7 genes of Candida albicans; 5' of EAF7" regulatory 2578..4050 /note="promoter region of ADH1 gene of Candida albicans; CaADH1p" /regulatory_class="promoter" regulatory 4064..4370 /note="terminator region of ACT1 gene of Candida albicans; ACT1 terminator" /regulatory_class="terminator" protein_bind 4407..4440 /label=Cre recombinase binding site /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT); loxP" CDS 5522..6916 /codon_start=1 /product="Arg4" /label=Arg4 /protein_id="AVR52630.1" /translation="MSQQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADLTGTK VYTQGLNKLGLITTEELNLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGEIIGK NISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMPGYTH LQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREFLAKG LGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLADAYS TGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEPLFDALT TVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHISGECVR KAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDAIGGTAKSAVLKQLEN LKSILN" protein_bind complement(7734..7767) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.