pCN56 vector (V008331)

LOCUS       V008331                 6592 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008331
VERSION     V008331
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6592)
  AUTHORS   Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R,
            King S, Hazbon MH.
  TITLE     Sequencing of a set of cassette-based shuttle vectors for
            Gram-positive bacteria deposited at BEI resources from the NARSA
            collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6592)
  AUTHORS   Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R,
            King S, Hazbon MH.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American
            Type and Culture Collection (ATCC), 10801 University Boulevard,
            Manassas, VA 20110-2209, USA
REFERENCE   3  (bases 1 to 6592)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6592)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 7.0.2
            Coverage              :: 38389
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and
            Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA
            20110-2209, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6592
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..2087
                     /note="T181cop-623 repC; Staphylococcus replication
                     cassette; high-copy-number variant; derived from J04764"
     misc_feature    158..391
                     /label="RS-B site"
                     /note="RS-B site"
     rep_origin      654..821
                     /note="ori; derived from Staphylococcus aureus"
     CDS             686..1630
                     /codon_start=1
                     /product="RepC protein"
                     /label="RepC protein"
                     /note="polypeptide A"
                     /protein_id="AMR43698.1"
                     /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF
                     DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD
                     RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK
                     KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV
                     DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP
                     VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK"
     variation       1130..1132
                     /label="E149D"
                     /note="E149D"
     misc_feature    1792..2087
                     /label="truncated polypeptide B"
                     /note="truncated polypeptide B"
     misc_feature    2406..2465
                     /label="leader peptide"
                     /note="leader peptide"
     CDS             2525..3256
                     /gene="ermC"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from
                     Staphylococcus aureus. Accession#: P02979"
     promoter        3624..3728
                     /label="AmpR promoter"
     CDS             3729..4586
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      4760..5348
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    5485..5529
                     /note="polylinker; derived from M13mp19"
     CDS             5563..6276
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     misc_feature    6288..6588
                     /label="blaZTT"
                     /note="blaZTT"
     misc_feature    6451..6588
                     /label="TT"
                     /note="TT"