Basic Vector Information
- Vector Name:
- pCN56
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6592 bp
- Type:
- Staphylococcal shuttle vector
- Replication origin:
- ori
- Source/Author:
- Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH.
pCN56 vector Vector Map
pCN56 vector Sequence
LOCUS V008331 6592 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008331 VERSION V008331 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6592) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Sequencing of a set of cassette-based shuttle vectors for Gram-positive bacteria deposited at BEI resources from the NARSA collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6592) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Direct Submission JOURNAL Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA REFERENCE 3 (bases 1 to 6592) TITLE Direct Submission REFERENCE 4 (bases 1 to 6592) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7.0.2 Coverage :: 38389 Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6592 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..2087 /note="T181cop-623 repC; Staphylococcus replication cassette; high-copy-number variant; derived from J04764" misc_feature 158..391 /label="RS-B site" /note="RS-B site" rep_origin 654..821 /note="ori; derived from Staphylococcus aureus" CDS 686..1630 /codon_start=1 /product="RepC protein" /label="RepC protein" /note="polypeptide A" /protein_id="AMR43698.1" /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK" variation 1130..1132 /label="E149D" /note="E149D" misc_feature 1792..2087 /label="truncated polypeptide B" /note="truncated polypeptide B" misc_feature 2406..2465 /label="leader peptide" /note="leader peptide" CDS 2525..3256 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" promoter 3624..3728 /label="AmpR promoter" CDS 3729..4586 /label="AmpR" /note="beta-lactamase" rep_origin 4760..5348 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 5485..5529 /note="polylinker; derived from M13mp19" CDS 5563..6276 /label="yeGFP" /note="yeast-enhanced green fluorescent protein" misc_feature 6288..6588 /label="blaZTT" /note="blaZTT" misc_feature 6451..6588 /label="TT" /note="TT"
This page is informational only.